module catalog

187 modules · generated from packages/web/src/lib/{audio,video}/modules/*.ts at build time

Cards below are auto-generated from each module's AudioModuleDef, SyncedModuleDef, or VideoModuleDef. I/O diagrams, port lists, and param tables are ground-truthed against the source — there is no second source of truth. If you change a module's ports or params, the next docs build picks it up. Ports are coloured by cable type: audio (cyan), cv (orange), gate (magenta), pitch (mint), polyPitchGate (violet); video cables (image / mono-video / video / keys) follow the same audio-cyan tone for now.

guides & hardware

Hand-written, illustrated walkthroughs that live alongside the auto-generated cards above — clip-launcher hardware (monome grid, Novation Launchpad), video mapping, and other modules with a dedicated guide.

sources

903A Random Signal Generator (moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). Passive white + pink noise source with two independent audio taps (WHITE = flat spectrum; PINK = -3 dB/oct, Voss-McCartney), scaled by a single LEVEL knob. No inputs. Own-code (public-domain noise technique). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

903a random signal generatorwhiteaudiopinkaudioaudiocvgatepitch

outputs

whiteaudioAudio signal.
pinkaudioAudio signal.

params

levellinear0..1(default 0.8)
source · moog903a.ts
921 vco sources

921 voltage-controlled oscillator (first module of the moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). Faithful to the original 921: ONE oscillator core presents FOUR simultaneous waveform jacks — sine, triangle, sawtooth, and rectangular with variable pulse width — all phase-coherent off the shared core. Pitch input is exponential 1V/oct (0V = C4); a dedicated LINEAR frequency-control input (lin_fm, scaled by the Lin FM depth) adds +/-Hz rather than octaves — it is one-sided in practice, because the core clamps at a positive 0.01 Hz floor, so a large negative excursion parks the oscillator instead of driving it through zero. A sync input drives the three-position SOFT / OFF / HARD sync switch for classic sync timbres. RANGE sets the coarse octave (+/-5 oct) and FREQ the fine tune (+/-12 st): together those two dials span 12 octaves, 4.09 Hz to 16.74 kHz, and both read 0 at the factory settings where it sings C4. WIDTH sets the rectangular duty cycle (with audio-rate width_cv) and is a pure timbre control — the tap level does not change across its span; LEVEL is the output gain on all four taps. The four jacks are NOT level-matched: at one LEVEL setting they sit within 4.8 dB of each other, rectangular loudest and sawtooth quietest. DSP is own-code: a clean-room polyBLEP/polyBLAMP band-limited oscillator (not a port of any moogafakkin schematic or copyleft source - permissive only). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

921 vcopitchpitchlin_fmaudiosyncaudiowidth_cvcvoctavecvtunecvlinFmAmountcvlevelcvsineaudiotriangleaudiosawtoothaudiorectangularaudioaudiocvgatepitch

inputs

pitchpitchV/oct pitch input (0V = C4). Exponential frequency control.
lin_fmaudioLinear frequency-control input (the 921's dedicated linear FM input); depth set by the Lin FM param.
syncaudioExternal sync source. Rising edges reset/nudge the phase per the SYNC switch (soft/off/hard).
width_cvcvAudio-rate pulse-width CV. Summed onto the WIDTH knob per-sample in the worklet (PASSTHROUGH_BY_DESIGN — width param already bounded 0.02..0.98, sum is clamped to range).
octavecvCV -> octave param.
tunecvCV -> tune param.
linFmAmountcvCV -> linFmAmount param.
levelcvCV -> level param.

outputs

sineaudioSine output.
triangleaudioTriangle output.
sawtoothaudioBand-limited sawtooth output.
rectangularaudioRectangular/pulse output; duty cycle = WIDTH.

params

octaveoct-5..5(default 0)
tunest-12..12(default 0)
widthlinear0.02..0.98(default 0.5)
linFmAmountlinear-1..1(default 0)
syncdiscrete-1..1(default 0)
levellinear0..2(default 1)
source · moog921-vco.ts
921b osc sources

921B Oscillator (moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). The slaved VCO driven by a 921A bus: it reads freq_bus (V/oct pitch) + width_bus (pulse width) CONTROL INPUTS from a 921A rather than carrying its own 1V/oct jack, and presents FOUR fixed-level simultaneous waveform outs off one common core — sine, triangle, saw, rectangular — clamped to 0.01 Hz at the bottom and to just under Nyquist at the top (23 520 Hz at a 48 kHz sample rate), not the hardware's nominal 40 kHz. The FREQUENCY pot is a 2-octave fine trim; the RANGE switch sets the octave footage; DC MODULATE is DC-coupled LINEAR FM (non-1V/oct, ±Hz); AC MODULATE is cap-coupled LINEAR FM (a DC-blocking high-pass runs first so a DC offset on the modulator doesn't bend the pitch); the SYNC input + 3-position SYNC switch (off / lo=soft / hi=hard) drive oscillator sync. With nothing patched the bus normals to C4 @ 50% duty so the 921B still sounds standalone, but it is designed to be driven by a 921A driver. DSP forks the shared own-code moogafakkin VCO core (clean-room polyBLEP/polyBLAMP band-limited oscillator + hard/soft sync, the same core the 921 VCO uses) - not a port of any moogafakkin schematic or copyleft source, permissive only. Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

921b oscfreq_buscvwidth_buscvdc_modaudioac_modaudiosyncaudiosineaudiotriangleaudiosawaudiorectaudioaudiocvgatepitch

inputs

freq_buscvControl voltage.
width_buscvControl voltage.
dc_modaudioAudio signal.
ac_modaudioAudio signal.
syncaudioAudio signal.

outputs

sineaudioAudio signal.
triangleaudioAudio signal.
sawaudioAudio signal.
rectaudioAudio signal.

params

finest-12..12(default 0)
rangeoct-5..5(default 0)
modAmountlinear-1..1(default 0)
syncModediscrete-1..1(default 0)
levellinear0..2(default 1)
source · moog921b.ts
acidwarp sources

acidwarp is a pure-GPU plasma SOURCE — it has no video input, it synthesizes its picture from math. It is a faithful port of Noah Spurrier's 1992-93 ACIDWARP demo: a 320x240 (NTSC 4:3) buffer of 8-bit palette indices is generated once per scene by a per-pixel formula (distance + angle + scaled sin/cos modulators, plus a few XOR scenes and recursive "rain" noise scenes), then every frame a 256-entry color palette is rotated by one or more slots and sampled per pixel. The scrolling palette is what makes the pattern appear to flow and pulse, even though the underlying index field is static until the scene changes. There are 41 scenes (concentric rings, simple rays, peacock, five-arm star, interference fields, rain/noise, interlaced two-screen variants, etc.) and 8 palettes (RGBW rainbow, greyscale, half-grey, pastel — each with an optional sparkle/"lightning" variant that brightens every 4th slot). Use it as a generative video bed: patch OUT into a mixer/feedback/output card, ride SPEED for the cycling rate, and nudge SCENE by hand or with a clock into scene_cv for rhythmic pattern changes. Slot 0 is reserved black, so palette rotation cycles only the 255 non-black colors.

acidwarpspeed_cvcvscene_cvcvoutvideoaudiocvgatepitch

inputs

speed_cvcvCV -> speed param.
scene_cvcvCV -> sceneTrig param.

outputs

outvideovideo

params

speedlinear0..1
freezediscrete0..1
scenediscrete0..?
paletteTypediscrete0..?
sceneTriglinear0..1
source · acidwarp.ts
analog vco sources

One phase accumulator, six taps: saw / square / triangle / sine, a saw→sine→square morph, and a sync pulse. Exponential FM and phase modulation, plus hard sync in.

analog vcopitchpitchfmaudiopmaudiosyncaudiotunecvfinecvfmAmountcvpmAmountcvshapecvsawaudiosquareaudiotriangleaudiosineaudiomorphaudiosyncaudioaudiocvgatepitch

inputs

pitchpitchV/oct pitch input.
fmaudioAudio-rate FM input (depth set by FM param).
pmaudioAudio signal.
syncaudioAudio signal.
tunecvCV -> tune param.
finecvCV -> fine param.
fmAmountcvCV -> fmAmount param.
pmAmountcvCV -> pmAmount param.
shapecvCV -> shape param.

outputs

sawaudioSawtooth output.
squareaudioSquare output (PW-modulated).
triangleaudioTriangle output.
sineaudioSine output.
morphaudioAudio signal.
syncaudioAudio signal.

params

tunesemi-36..36(default 0)
finecent-100..100(default 0)
fmAmountlinear-1..1(default 0)
pmAmountlinear-1..1(default 0)
pwlinear0.05..0.95(default 0.5)
shapelinear0..1(default 0)
source · analog-vco.ts
archivist sources

ARCHIVIST — universal Internet Archive (archive.org) media SOURCE. Pick a media type (IMAGE / AUDIO / VIDEO / ANY), type a search term + press Enter, and the card searches archive.org, picks a RANDOM matching item, and loads it; "↻ next" re-rolls another random match from the same results. Optional FROM/TO year-range narrows the search (e.g. 1970–1989). All searching + metadata happen client-side (the archive.org search + metadata APIs are CORS-open, so NO proxy is needed). PER-TYPE OUTPUTS (subject to archive.org CORS on the SERVED file — verified): IMAGE → the still image is uploaded as a CORS-clean WebGL texture on the `image` output (image upcasts to `video` for free, so it can drive video inputs). AUDIO → the clip plays + scrubs and its stereo audio routes out CORS-clean on `audio_l` / `audio_r` (analysable downstream, e.g. into SYNESTHESIA for beats). VIDEO → archive.org does NOT send CORS headers on served video files, so the clip is PLAY-ONLY: it plays + scrubs in the card preview, but the texture would be tainted, so the `video` output is NOT delivered for an archive video (the card shows a "play-only" warning). SCRUBBING for time-media (audio + video): a draggable timeline seeks the playhead, with ±10s skip, a "jump to random position" button (⤭), and an mm:ss readout — robust to archive.org's byte-range support (verified: audio + video serve HTTP 206 ranges). GATE/TRIGGER + CV OUTPUTS: `loaded` (trigger — a short pulse each time a new item finishes loading, any type), `ended` (trigger — pulses when a time-media item reaches its end), `playing` (gate — HIGH while a time-media item is playing), and `playhead` (CV — 0..1 normalized playhead position). The `play_trigger` gate INPUT toggles play/pause on a rising edge. PATCHING: all inputs + outputs live in the card's yellow drill-down PATCH PANEL (top-left / top-right affordances → INPUT / OUTPUT → grouped Gates / CV / Audio / Video rows) — there are no side jacks. PLAYABLE-FILE PICKING: for video the card prefers an HTML5-playable derivative (h.264 .mp4 → theora .ogv → .webm) chosen by the metadata format token, NOT just the file extension — so an un-decodable MPEG-4-Part-2 / HEVC .mp4 ORIGINAL or an old MPEG-2 / AVI / MOV is skipped; if the picked file still can't decode, the card surfaces a "couldn't play — skipping" status and AUTO-ADVANCES to the next random match (it never hangs on "Loading"). Only publicly-streamable items are loaded (the query excludes access-restricted / lending / DMCA items). Attribution: the card surfaces the item title + a link to its archive.org details page and labels the source as Internet Archive. A clean VIDEO texture output would require a same-origin streaming proxy (re-serving archive.org video with our own CORS + Range passthrough) — out of scope for v1; image + audio ship with real clean outputs, video ships play/scrub-only with the limitation documented.

archivistplay_triggergateimageimagevideovideoaudio_laudioaudio_raudioloadedgateendedgateplayinggateplayheadcvaudiocvgatepitch

inputs

play_triggergateGate signal (rising/falling edge).

outputs

imageimageimage
videovideovideo
audio_laudioAudio signal.
audio_raudioAudio signal.
loadedgateGate signal (rising/falling edge).
endedgateGate signal (rising/falling edge).
playinggateGate signal (rising/falling edge).
playheadcvControl voltage.

params

gainlinear0..2
cv_play_triggerlinear0..1(default 0)
source · archivist.ts
audio in sources

System audio input source. Stream from a user-selected mic/line-in/interface via getUserMedia; L+R outputs are fanned out from mono sources or split from stereo. Card owns the permission prompt + device dropdown + devicechange refresh.

audio inaudio_l_outaudioaudio_r_outaudioaudiocvgatepitch

outputs

audio_l_outaudioAudio signal.
audio_r_outaudioAudio signal.

params

gaingain0..2(default 1)
source · audioin.ts
blood singleton sources

Interactive BLOOD video source — the NBlood (Build-engine) port of Blood, compiled to WebAssembly and rendered as a video module. Owner-only and single-instance, like DOOM: the rack owner spawns it and plays; the video output is the Build software-rendered framebuffer, aspect-correct letterboxed into the canvas. CV-typed gate inputs (up/down/left/right, fire, altfire, use, jump, crouch, weapnext/weapprev, esc, enter) drive the marine from cables, and the focused card also captures the keyboard. Stereo audio_l/audio_r outputs are wired but silent in v1 (the PCM bridge is stubbed). The card boots OUT-OF-BOX: the 1997 Blood SHAREWARE data ("The Way of All Flesh", episode 1: maps E1M1-E1M8) is bundled under static/blood/ and LFS-tracked, so no picker is needed. The "Load full Blood data…" picker is an optional override — supply a copy of the full game you own (GOG/Steam One Unit Whole Blood or Fresh Supply) to play all episodes.

blood · singletonoutvideoaudio_laudioaudio_raudioaudiocvgatepitch

outputs

outvideovideo
audio_laudioAudio signal.
audio_raudioAudio signal.

params

audioGainlinear0..2(default 1)
fillModediscrete0..1
source · blood.ts
bluebox sources

DTMF dialer with phreaker buttons. 12-key phone keypad — digits 0-9 emit the Bell-System dual-tone pair (row + col, e.g. "5" → 770 Hz + 1336 Hz); BLUEBOX emits a single 2600 Hz sine (the AT&T in-band supervisory tone that 1970s phreakers used to seize long-distance trunks); REDBOX emits 1700 + 2200 Hz summed (the US payphone coin-acceptance pair). Each key is push-to-talk — pointerdown on the card OR a gate cable into the matching gate_<name> input holds the key down. Multiple held keys sum, and shared frequencies (e.g. "1" and "4" both pull col=1209) collapse onto a single shared phase accumulator so simultaneous presses produce a louder tone, not a flam — and a LOUDER one than a pair that shares nothing (1+4 beats 1+5 by 1.76 dB). No musical AD you can dial — bare on/off sines through a one-pole anti-click ramp (τ ≈ 1 ms), inaudibly fast on the way up and about 15 ms to silence on release. The mono sum is scaled by 1/4: one digit sits 18 dB below full scale, eight simultaneous digits reach it, and all twelve keys overshoot by about 2.5 dB.

blueboxgate_1gategate_2gategate_3gategate_4gategate_5gategate_6gategate_7gategate_8gategate_9gategate_0gategate_blueboxgategate_redboxgateoutaudioaudiocvgatepitch

inputs

gate_1gateGate signal (rising/falling edge).
gate_2gateGate signal (rising/falling edge).
gate_3gateGate signal (rising/falling edge).
gate_4gateGate signal (rising/falling edge).
gate_5gateGate signal (rising/falling edge).
gate_6gateGate signal (rising/falling edge).
gate_7gateGate signal (rising/falling edge).
gate_8gateGate signal (rising/falling edge).
gate_9gateGate signal (rising/falling edge).
gate_0gateGate signal (rising/falling edge).
gate_blueboxgateGate signal (rising/falling edge).
gate_redboxgateGate signal (rising/falling edge).

outputs

outaudioAudio signal.

params

btn_1linear0..1(default 0)
btn_2linear0..1(default 0)
btn_3linear0..1(default 0)
btn_4linear0..1(default 0)
btn_5linear0..1(default 0)
btn_6linear0..1(default 0)
btn_7linear0..1(default 0)
btn_8linear0..1(default 0)
btn_9linear0..1(default 0)
btn_0linear0..1(default 0)
btn_blueboxlinear0..1(default 0)
btn_redboxlinear0..1(default 0)
source · bluebox.ts
camera sources

Webcam input (LOCAL ONLY). Live <video> -> WebGL2 texture; gain / mirror / on params. The captured stream is local to your browser tab and is NOT sent to other rack-mates — collaborators see a presence badge ("user X has CAMERA active") via Y-awareness, not the video itself. Multiplayer streaming (WebRTC + SFU) is deferred to a future phase.

cameragaincvmirrorgateoutvideoaudiocvgatepitch

inputs

gaincvCV -> gain param.
mirrorgateGate signal (rising/falling edge).

outputs

outvideovideo

params

gainlinear0..2
enableddiscrete0..1
mirrordiscrete0..1
fillModediscrete0..1
source · camera-input.ts
clap sources

Analog-modeled HANDCLAP voice — the fourth member of the drum family (KICK DRUM / SNARE DRUM / TOM DRUM), at deliberately CURATED complexity: one synthesis engine, eight voice knobs + level, spanning the classic clap circuits in one continuous space (TR-808 canonical twin-VCA burst+tail, TR-909 dense bright machine burst, Simmons-ClapTrap spread, LinnDrum-era dark room clap). DSP (own-code, packages/dsp/src/lib/clap-dsp.ts): seeded white noise → COLOR one-pole tilt (log-swept 9 kHz→700 Hz, white→dark, gain-compensated) → Chamberlin band-pass at TONE (400–3000 Hz; the 808 sits near 1 kHz, the 909 near 1.14 kHz) with WIDTH morphing ringy Q≈5.5 → broad splash (1/√q loudness-compensated) → the 808 twin-VCA topology: a BURST of PULSES (2–5) retriggered envelopes SPREAD ms apart (4–25, latched per hit; each pulse decays −60 dB in exactly the spacing — the quad-comparator sawtooth cycles — and the FINAL pulse rings 2× longer, the uninterrupted last discharge) summed with a separate smooth reverb TAIL envelope (30–800 ms, fired at the last pulse, fed one pole darker — the fake room). SNAP is the equal-power burst↔room balance (1 = bone-dry machine clap, 0 = room only); DRIVE a 2×-oversampled warm-tanh; then 20 Hz DC block, dB LEVEL, and a true-peak tanh bound (|out| < 1 always). Inputs: trigger_in (edge-trigger STRIKE — burst geometry + accent latched, noise reseeded: every hit bit-identical), accent_in (per-hit 0..1 CV latched at the strike edge: up to +80 % velocity AND +60 % room excitation — a harder clap is bigger, not just louder), tone_cv (±1.5 oct/V — ±1 V covers the whole knob range), tail_cv (2 oct of tail time per volt), spread_cv (±1.3 oct/V, latched per hit — the ClapTrap random-spread trick, deterministic). Output: ONE mono audio_out. Card: compact BURST·NOISE·ROOM/OUT fader band + a press-to-fire CLAP pad (the `strike` param, OR-ed with trigger_in in the worklet — one clap per press edge).

claptrigger_ingateaccent_incvtone_cvcvtail_cvcvspread_cvcvaudio_outaudioaudiocvgatepitch

inputs

trigger_ingateGate signal (rising/falling edge).
accent_incvControl voltage.
tone_cvcvControl voltage.
tail_cvcvControl voltage.
spread_cvcvControl voltage.

outputs

audio_outaudioAudio signal.

params

pulsesdiscrete2..5(default 3)
spreadms4..25(default 10)
toneHz400..3000(default 1000)
widthlinear0..1(default 0.5)
tailms30..800(default 150)
colorlinear0..1(default 0.15)
snaplinear0..1(default 0.5)
drivelinear0..1(default 0.2)
leveldB-24..12(default 0)
strikediscrete0..1(default 0)
source · clap.ts
cube sources

3D wavetable-navigator oscillator. Builds a 3D scalar field — "the cube," a space that is a mix of solid and filled — out of THREE e352 wavetables (FLOOR / WALL / CEILING, each independently chosen from WAVESCULPT's full preset set, defaults FLOOR=basic-shapes, WALL=pwm-sweep, CEILING=harmonic-sweep — ALL THREE must differ or one control dies by arithmetic: FLOOR=CEILING makes MORPH algebraically inert, and either connector slot matching WALL sends the occupancy function into its degenerate hard-step branch and kills CONNECT and CONNECT STRENGTH outright. The faceplate's table-stack panel draws the three heightfields and names the casualty when it happens), then flies an arbitrary planar SLICE through the field and reads it back as the played waveform via a SURFACE-HEIGHT SCAN: for each of 256 x-positions the sample = how far the solid extends along the slice (intersection depth), so the cube's shape literally becomes the wave. MORPH connects the wall to the floor (at min) or the ceiling (at max), weighted-averaged in between; CONNECT morphs the connecting curve from a circle arc to a sawtooth-V touching the floor, and CONNECT STRENGTH overshoots the connector's interior control point "out of the cube" for a dramatic swell of the solid base (0 = today's exact shape). The slice navigates with Y (up/down) + Rot X/Y/Z (Euler rotation on all 3 axes). MATERIAL switches SMOOTH (continuous density) ↔ HARD (binary solid in/out). CRUSH is a 3D bitcrush reducing spatial-grid + amplitude resolution (default 0 = transparent → blocky/steppy at max); SPACE CRUSH is an independent spatial voxelization of just the FIELD lookup coordinates (chunky voxels, 0 = transparent), and SPACE DIFFUSE applies a gravity that pulls the sampled cloud toward the cube's lowest-information (emptiest) wall — the target wall latches when the tables/morph change, not as the knob moves (0 = off). WRAP toggles whether a slice extending outside the cube is silent (default) or mirror-folds back to the opposite side. A V/oct pitched oscillator (pitch input + tune/fine) with stereo L/R SPREAD on SEPARATE L and R output ports (max ±18% of the cube depth between channels — the L slice is read below center, the R above, and the separate ports mean the offset survives patching into mono inputs; measured, the resulting image is NARROW, about -36 dB of side against mid at the stop with the two channels 0.99998 correlated, so treat SPREAD as a widener rather than a stereo field). View-only Zoom + Rot X/Y orbit the WebGL2 3D cube visualization (dragging the faceplate hero writes the same two angles) (the scalar field rendered as a translucent voxel slice-stack with the live selection slice shown as a square plane cutting through it) without affecting the sound or the selected slice. CV inputs cover the expressive params (slice Y/rotation, morph, connect, connect strength, crush, space crush, space diffuse, fold, tune). A POLY input (polyPitchGate) accepts the 5-voice chord bus from MIDI LANE (mode=poly) or POLYSEQZ: when any lane is gated CUBE runs one phase accumulator per gated lane through the SAME posted slice waves at that lane's pitch and sums them — polyphonic, with the slice/field timbre shared across voices; with nothing patched to poly the mono `pitch` path runs unchanged. A per-voice amplitude ADSR (Attack / Decay / Sustain / Release) plus a BASE VOL knob shape each voice. GATING is decided by what is PATCHED: when the POLY bus OR the mono TRIGGER is connected, CUBE is a GATED voice — a lane/voice sounds only while it is gated-or-releasing, and a never-gated lane is SILENT (patching poly never auto-drones). When NEITHER is patched, CUBE is a continuous raw VCO. BASE VOL is a per-voice VCA FLOOR the envelope rides on top of: gain = base + (1-base)·env per ACTIVE voice — base=0 (the default) is pure ADSR (silent between notes), 0.5 floors at 0.5 and rises to 1.0 at the env peak, base=1 means the env does nothing (full gain while active). It applies ONLY to gated voices: the raw-VCO case (nothing patched) runs at unity independently of BASE, so the legacy continuous drone is byte-identical at every setting. In poly mode each lane's gate edge drives its own envelope (one per voice, soft/click-safe retrigger), and the mix is normalized over ACTIVE voices (1/sqrt(N)) so a sustain=0 held note doesn't pump and a releasing tail doesn't pop. The ADSR + BASE VOL params read live (continuous k-rate) across all stages. Edge detection is block-rate (retrigger granularity floor ≈ one audio block); connectedness (poly/trigger patched) is read from the live patch edges, not bus presence. Pure deterministic field/slice DSP in cube-dsp.ts is reused verbatim by node-ART AND by the card's 3D render, and the surface-height scan runs OFF the audio thread (computed on the main thread, posted to the worklet) so sweeping params never drops the audio out. A VIDEO OUT port carries a live render of that same 3D view to any video module. SYNC is a pure sine off the playback phase that is NOT scaled by LEVEL and runs about 6 dB hotter than the L/R pair, so mixing it alongside them is a level surprise. Only PITCH is audio-rate: every other CV jack is summed into an AudioParam the worklet samples once per block (~375 Hz), quantised to 1/512 of range and 80 Hz-smoothed, so an audio-rate source into one of them aliases rather than modulates.

cubepitchcvpolypolyPitchGatetriggergateslice_ycvslice_rxcvslice_rycvslice_rzcvmorph_fccvconnectcvconnect_strengthcvcrushcvspace_crushcvspace_diffusecvfold_cvcvtunecvLaudioRaudiosyncaudiovideo_outmono-videoaudiocvgatepitch

inputs

pitchcvControl voltage.
polypolyPitchGatepolyPitchGate
triggergateMono TRIGGER gate for the per-voice amplitude ADSR (drives lane-0's envelope when POLY is unpatched). A level gate, not a pulse: rising edge = note-on (attack), falling edge = note-off (release). PATCHING this (or POLY) makes CUBE a GATED voice — silent until the first note, then base-floored (BASE VOL) once active; releasing tails finish. When neither this nor POLY is patched CUBE free-runs as a continuous raw VCO at the BASE VOL level (default 1 = the legacy drone, byte-identical).
slice_ycvCV -> slice_y param.
slice_rxcvCV -> slice_rx param.
slice_rycvCV -> slice_ry param.
slice_rzcvCV -> slice_rz param.
morph_fccvCV -> morph_fc param.
connectcvCV -> connect param.
connect_strengthcvCV -> connect_strength param.
crushcvCV -> crush param.
space_crushcvCV -> space_crush param.
space_diffusecvCV -> space_diffuse param.
fold_cvcvCV -> fold param.
tunecvCV -> tune param.

outputs

LaudioLeft audio out (slice read at -SPREAD depth). Separate from R so the stereo SPREAD survives mono inputs.
RaudioRight audio out (slice read at +SPREAD depth). Separate from L so the stereo SPREAD survives mono inputs.
syncaudioAudio signal.
video_outmono-videomono-video

params

tunest-36..36(default 0)
fine¢-100..100(default 0)
morph_fclinear0..1(default 0)
connectlinear0..1(default 0)
connect_strengthlinear0..1(default 0)
crushlinear0..1(default 0)
space_crushlinear0..1(default 0)
space_diffuselinear0..1(default 0)
foldlinear0..1(default 0)
spreadlinear0..1(default 0)
slice_ylinear0..1(default 0.5)
slice_rxlinear-3.1416..3.1416(default 0)
slice_rylinear-3.1416..3.1416(default 0)
slice_rzlinear-3.1416..3.1416(default 0)
levellinear0..2(default 1)
attacks0.001..5(default 0.001)
decays0.001..5(default 0.1)
sustainlinear0..1(default 1)
releases0.001..5(default 0.005)
base_vollinear0..1(default 0)
wrapdiscrete0..1(default 0)
materialdiscrete0..1(default 0)
view_zoomlog0.3..3(default 1)
view_rot_xlinear-3.1416..3.1416(default 0.6)
view_rot_ylinear-3.1416..3.1416(default 0.7)
screen_ondiscrete0..1(default 1)
source · cube.ts
doom singleton sources

DOOM runs the 1993 shareware game compiled to WebAssembly (doomgeneric) and renders each peer's OWN first-person view to the video 'out' jack, with the WASM SFX mixer bridged to stereo audio outputs. It is a host-only, single-node module (maxInstances 1, ownerOnly): the rack owner adds one DOOM card, clicks the surface to download/cache the ~4 MB shareware WAD and boot the WASM, then either plays solo or hosts a true-lockstep co-op netgame that up to 3 rack-mates one-click hot-join (4 marines total — the owner is player 1) — every peer runs its own runtime and the deterministic tic stream keeps all marines byte-identical. Play with the keyboard once the card is focused (arrows move/turn, Ctrl/F fire, Space uses doors), or drive it from CV: the per-slot gate inputs p1..p4 act as held keypresses (movement/fire/strafe/menu) so an LFO, sequencer, or GAMEPAD can play the marine — each peer applies only its own seated slot's group (own-slot rule), and in single-player only the p1 group is live. Two extra cheat gates inject IDDQD (god mode) and IDKFA (full arsenal) on a rising edge. Game events feed the audio domain as 10 ms gate pulses — per-player weapon fire, door opens, the any-monster kill plus per-monster-type kills, and per-player deaths — so DOOM's action can trigger synths, drums, or a SCOREBOARD. The card's load button, the Single Player / Host Multiplayer start choice, the guest Join button, the click-to-capture-keyboard hint, and the arbiter's New Game dialog (mode/skill/episode/map custom dropdowns + a Launch / Next Map button) are UI controls, not patchable params. There is no host framebuffer mirror — an unjoined spectator simply shows the dark attract screen until it JOINS.

doom · singletoniddqd_incvidkfa_incvoutvideoaudio_laudioaudio_raudioevt_killgateevt_doorgateevt_gun_p1gateevt_gun_p2gateevt_gun_p3gateevt_gun_p4gateaudiocvgatepitch

inputs

iddqd_incvCV -> cv_iddqd_in param.
idkfa_incvCV -> cv_idkfa_in param.

outputs

outvideovideo
audio_laudioAudio signal.
audio_raudioAudio signal.
evt_killgateGate signal (rising/falling edge).
evt_doorgateGate signal (rising/falling edge).
evt_gun_p1gateGate signal (rising/falling edge).
evt_gun_p2gateGate signal (rising/falling edge).
evt_gun_p3gateGate signal (rising/falling edge).
evt_gun_p4gateGate signal (rising/falling edge).

params

audioGainlinear0..2(default 1)
fillModediscrete0..1
cv_iddqd_inlinear0..1(default 0)
cv_idkfa_inlinear0..1(default 0)
source · doom.ts
drummergirl sources

Gate-triggered drum voice (kick / snare / hat morph).

drummergirlgategatepitchcvtonecvshapecvvolumecvdecaycvaudioaudioaudiocvgatepitch

inputs

gategateTrigger.
pitchcvCV -> pitch.
tonecvCV -> tone.
shapecvCV -> shape.
volumecvCV -> volume param.
decaycvCV -> decay param.

outputs

audioaudioMono drum out.

params

pitchsemi-36..36(default 0)
tonelinear0..1(default 0.3)
shapelinear0..1(default 0.3)
volumelinear0..2(default 1)
decays0.001..0.5(default 0.15)
source · drummergirl.ts
dx7 sources

Pure-TypeScript 6-operator DX7-style FM synthesizer. 32 algorithms, 5-voice polyphony via the polyPitchGate cable, bundled bank of factory-inspired patches (E.PIANO 1, BASS 1, HARMONICA, STRINGS 1, MARIMBA, etc.), and a .syx file picker for loading custom 32-voice cartridge dumps (in-memory only). On top of the six per-operator DX7 envelope generators, a per-voice master OUTPUT-VCA ADSR (Attack / Decay / Sustain / Release) gives a player-dialable amplitude swell / long-release without editing the SYX: one envelope per voice multiplies the summed-carrier output, gated by the same note-on/note-off as the operator EGs (soft/click-safe retrigger). Defaults are ~pass-through (fast attack, full sustain, fast release) so loaded patches sound identical until you touch the master ADSR; a long master release now outlives operator-EG silence (a voice frees only once both the operator EGs and the master amp envelope have faded). NOT a Plaits-backed implementation.

dx7polypolyPitchGatepitch_cvcvgategateoutaudioaudiocvgatepitch

inputs

polypolyPitchGatePolyphonic pitch+gate input (10 channels = 5 lanes of pitch+gate). Drive from a SEQUENCER / CARTESIAN poly output for chord playback; each lane allocates one DX7 voice. Round-robin allocation with steal-oldest when all 5 voices busy.
pitch_cvcvMono V/oct pitch input (legacy / single-voice fallback — drives lane 0 if no poly cable is patched).
gategateMono gate input (legacy / single-voice fallback — drives lane 0).

outputs

outaudioMono audio output (sum of all active voice carriers).

params

algorithmdiscrete1..32(default 5)
feedbackdiscrete0..7(default 4)
voiceCountdiscrete1..5(default 5)
levellinear0..2(default 0.7)
transposest-24..24(default 0)
attacks0.001..5(default 0.001)
decays0.001..5(default 0.1)
sustainlinear0..1(default 1)
releases0.001..5(default 0.005)
source · dx7.ts
foxy sources

Hybrid audio-visual module that hides a whole signal chain in one box: a miniature SWOLEVCO drives an internal RASTERIZE (audio painted as a drifting raster), which is downsampled to 256×256 and run through a simplified RUTTETRA "XYZ" forward-scatter scope; the XYZ height field is converted in realtime into an animated wavetable (64 frames × 256 samples, throttled to ~24 Hz) fed to an internal WAVECEL wavetable VCO. The on-card 3D wavetable display visibly animates as the field evolves. Exposes WAVECEL's full control + IO surface (tune/fine/morph/spread/fold; pitch/fm + morph_cv/spread_cv/fold_cv; out_l/out_r + scope_out + wave3d_out) plus the mini-SWOLEVCO source controls and the XYZ shape/displacement knobs. The video stages run CPU-side on the main thread (no GL inside the audio node); only the WAVECEL stage is a real worklet.

foxypitchpitchfmaudiomorph_cvcvspread_cvcvfold_cvcvout_laudioout_raudioscope_outmono-videowave3d_outvideocombined_outvideoaudiocvgatepitch

inputs

pitchpitchV/oct pitch CV.
fmaudioAudio signal.
morph_cvcvCV -> morph param.
spread_cvcvCV -> spread param.
fold_cvcvCV -> fold param.

outputs

out_laudioAudio signal.
out_raudioAudio signal.
scope_outmono-videomono-video
wave3d_outvideovideo
combined_outvideovideo

params

tunest-36..36(default 0)
fine¢-100..100(default 0)
morphlinear0..1(default 0)
spreadlinear1..5(default 1)
foldlinear0..1(default 0)
src_tunest-36..36(default 0)
src_fine¢-100..100(default 0)
src_timbrelinear0..1(default 0.3)
src_symmetrylinear0..1(default 0.5)
src_foldlinear0..1(default 0.2)
src2_tunest-36..36(default 7)
src2_fine¢-100..100(default 0)
src2_timbrelinear0..1(default 0.5)
src2_symmetrylinear0..1(default 0.3)
src2_foldlinear0..1(default 0.4)
src3_tunest-36..36(default -12)
src3_fine¢-100..100(default 0)
src3_timbrelinear0..1(default 0.4)
src3_symmetrylinear0..1(default 0.7)
src3_foldlinear0..1(default 0.3)
xyz_xshapelinear0..1
xyz_yshapelinear0..1
xyz_ydisplinear-1..1
xyz_warplinear0..1
xyz_zheightlinear0..1
xyz_zoomlinear1..8(default 4)
xyz_smoothlinear0..1(default 0.5)
sync_modediscrete0..?(default 0)
freezeRasterAdiscrete0..1(default 0)
freezeRasterBdiscrete0..1(default 0)
freezeRasterCdiscrete0..1(default 0)
freezeTablediscrete0..1(default 0)
gen_modediscrete0..?(default 0)
source · foxy.ts
gibribbon sources

GIBRIBBON (video) — an AUDIO-DRIVEN rhythm line-runner in the spirit of Vib-Ribbon, cast with DOOM shareware sprites as fair-use artistic parody (owner-ruled rewrite 2026-08-28; audio-in redirect 2026-08-29). Like the original game — which analyses the music (any CD the player inserts) and builds its course from interesting frequency changes — the course derives from whatever is patched into AUDIO IN: the module's own analyser folds the signal into four musical bands (bass 20-200 / low-mid 200-1k / high-mid 1k-4k / treble 4k-16k Hz), and an ADAPTIVE extractor spawns events on relative peaks against each band's own rolling baseline, biased toward spectral-flux onsets — any source at any level plays, silence and stuck-flat signals spawn nothing, and there is no gain calibration anywhere in the path. THE BAND IS THE EVENT: bass=LOOP road dips (A), low-mid=JUMP humps (B), high-mid=IMP (X), treble=ZOMBIE (Y) — the low end shapes the road, the highs send the monsters (real TROO*/POSS* sprites when DOOM1.WAD is present, line-art otherwise; the marine is PLAY*). THE DAMAGE MODEL IS VIB-RIBBON'S: an uncleared event HITS the marine and degrades him one VISIBLE form down a DOOM ladder (the status-bar face mugshot grades from grin to bloodied; the line-art figure loses limbs), like Vibri degrading rabbit-to-frog-to-insect; hits at the floor are GAME OVER (evt_gameover pulses; the restart gate / R key / RESET revives); streaks heal and a long streak reaches gold SUPER. One clock: the internal TEMPO transport paces the ribbon while the audio decides what spawns; judgement is phase-anchored to it. An idle unpatched module self-plays in labelled ATTRACT (its bot deliberately fumbles so the ladder shows); any input — buttons, keyboard, or MOVING audio — starts a real run. Outputs: out (video), evt_hit/miss/fire/kill/gameover (10 ms gates), health_cv. Pure deterministic engine (gibribbon-engine.ts) + pure spectral fold (gibribbon-spectral.ts); VRT-baselined via the __gibribbonVrtSeed/__gibribbonVrtTicks pins. DOOM shareware terms apply (same file as the DOOM module, read-only).

gibribbonaudio_inaudioxmodsignalymodsignalagatebgatex_btngatey_btngaterestartgateoutvideoevt_hitgateevt_missgateevt_firegateevt_killgateevt_gameovergatehealth_cvcvaudiocvgatepitch

inputs

audio_inaudioAudio signal.
xmodsignalmodsignal
ymodsignalmodsignal
agateGate signal (rising/falling edge).
bgateGate signal (rising/falling edge).
x_btngateGate signal (rising/falling edge).
y_btngateGate signal (rising/falling edge).
restartgateGate signal (rising/falling edge).

outputs

outvideovideo
evt_hitgateGate signal (rising/falling edge).
evt_missgateGate signal (rising/falling edge).
evt_firegateGate signal (rising/falling edge).
evt_killgateGate signal (rising/falling edge).
evt_gameovergateGate signal (rising/falling edge).
health_cvcvControl voltage.

params

axis_xlinear-1..1(default 0)
axis_ylinear-1..1(default 0)
btn_alinear0..1(default 0)
btn_blinear0..1(default 0)
btn_xlinear0..1(default 0)
btn_ylinear0..1(default 0)
restart_btnlinear0..1(default 0)
autoplaydiscrete0..1(default 1)
difficultylinear0..1(default 0.5)
tempolog60..180
source · gibribbon.ts
inwards sources

A procedural source that synthesizes a field of concentric rings centered on the frame, with their phase scrolling inward over time so the bands appear to zoom toward the center (positive Speed) or outward (negative). The shader takes the radial distance from center, multiplies it by Density to set how many rings fit on screen, then subtracts time*Speed to animate the sweep; an abs(sin) wave is soft-banded by Thickness to render alternating bright and dark grayscale rings. There is no video input — it generates its image entirely from time and the three params, so it works without camera permissions. Use it as a hypnotic radial backdrop or a moving mask/wipe source: patch an LFO or envelope into Speed for pulsing zoom, or sweep Density for a tunnel-breathing effect.

inwardsspeedcvdensitycvthicknesscvoutmono-videoaudiocvgatepitch

inputs

speedcvCV -> speed param.
densitycvCV -> density param.
thicknesscvCV -> thickness param.

outputs

outmono-videomono-video

params

speedlinear-2..2
densitylinear1..50
thicknesslinear0..1
source · inwards.ts
karplus sources

Extended Karplus-Strong STRING/HARP VOICE built on the COFEFVE DELAY's own fractional delay-line core (owner directive — no parallel delay implementation): a strike fires a seeded noise burst into a recirculating delay-line "string" and the ring IS the note, decaying like a real vibrating string. The full Jaffe–Smith/CCRMA EKS extension set, curated to 6 voice knobs + CV: DECAY is t60 in real SECONDS, frequency-compensated with the ρ = 0.001^(1/(f0·t60)) per-period loss law so low notes do NOT ring 10× longer than high ones (the classic K-S sin, fixed); BRIGHT is the string material — an in-loop damping low-pass whose cutoff TRACKS the note (fc = f0·2^(0.5+5.5·knob), so ≈1.4×f0 felt-dark … 64×f0 steel-bright, the Rings damping vocabulary), phase-compensated at f0 so it never detunes the note (below BRIGHT ≈0.1 the safety cap on loop gain does shorten it — a dark string cannot ring for 10 s); POS is the pick position (feedforward comb at β of the period — β=0.5 cancels even harmonics for a hollow mid-pluck, small β = bridge-thin); STIFF adds dispersion allpasses that stretch upper partials SHARP toward piano wire / bell / gong; COLOR (200 Hz mallet → 10 kHz pick low-pass) and BURST (0.1–4 PERIODS of noise, energy-normalized: near-impulse tick → classic 1-period pluck → scraped/bowed onset) shape the exciter. Tuning: 1 V/oct (f0 = Tune × 2^V, 30 Hz–4.2 kHz) with every loop stage's phase delay at f0 compensated in closed form and the fraction realized by the cofefve Catmull-Rom read — measured ≤ 0.1 cents across C2–C7 (unit-gated < 3). Inputs: trigger_in (edge-trigger STRIKE, burst reseeded per hit — deterministic), pitch (1 V/oct), accent_in (per-hit velocity latched at the edge: louder + brighter), damp_in (level-sensitive palm mute WHILE high, ~50 ms choke), plus a per-control CV on EVERY one of the eight knobs (tune_cv/decay_cv/bright_cv/position_cv/stiff_cv/color_cv/burst_cv/level_cv — each ±1 sweeps its param full-range around the knob, all 80 Hz-smoothed in the worklet, so `pitch` is the module's only genuinely audio-rate input). Mono out (the string tap, taken pre-damping) with LEVEL −24..+12 dB. Card: STRING·EXCITER fader bands + a PLUCK audition button (fires the canonical shared trigger pulse). RACKLINE face (?shell=1): hero ranks DECAY + BRIGHT with a live output scope; pages string·ring / pick·strike / output; rear card groups the four play jacks into a striking hand (STRIKE + ACCENT) and a fretting hand (1 V/OCT + DAMP). Stability is proven, not hoped: modes k ≥ 1 are bounded by ρ < 1 and the k = 0 loop mode is pinned below unity by an f0-tracked DC blocker (unit-gated at the hostile knob extremes).

karplustrigger_ingatepitchpitchaccent_incvdamp_ingatedecay_cvcvbright_cvcvposition_cvcvstiff_cvcvcolor_cvcvtune_cvcvburst_cvcvlevel_cvcvoutaudioaudiocvgatepitch

inputs

trigger_ingateGate signal (rising/falling edge).
pitchpitchV/oct pitch CV.
accent_incvControl voltage.
damp_ingateGate signal (rising/falling edge).
decay_cvcvCV -> decay param.
bright_cvcvCV -> brightness param.
position_cvcvCV -> position param.
stiff_cvcvCV -> stiffness param.
color_cvcvCV -> color param.
tune_cvcvCV -> tune param.
burst_cvcvCV -> burst param.
level_cvcvCV -> level param.

outputs

outaudioAudio signal.

params

tuneHz55..1760(default 220)
decays0.1..10(default 2)
brightnesslinear0..1(default 0.7)
positionlinear0.02..0.5(default 0.2)
stiffnesslinear0..1(default 0)
colorlinear0..1(default 0.6)
burstlog0.1..4(default 1)
leveldB-24..12(default 0)
source · karplus.ts
kick drum sources

Layered stereo kick VOICE — the "shake the house" deep-bass kick (own-code). Three DECOUPLED generator layers so depth and punch live on orthogonal knobs: a pure-sine SUB (Tune 20–120 Hz, gentle slow settle, long Sub Dec ≤ 800 ms — the air-moving pulse), a band-limited BODY one octave up (fast downward P Amt/P Time pitch sweep — the 909 "dooo" chest-thump — plus Shape sine→tri→rect morph and a Tension amplitude→pitch glide), and a filtered-noise CLICK transient (Click len / Clk Tone / Clk Lvl). The summed layers run a serial bus: DRIVE saturation with a single HARD character switch (clean-warm vs aggressive, owner-decided instead of a mode menu), an own-code 3-band kick EQ (Sub/Body/Atk EQ bells + a spectral Tilt), and the TRANSLATE harmonic exciter that synthesizes the sub's 2nd/3rd/4th harmonics so a 40–50 Hz fundamental still reads deep on laptop/phone speakers. DYNAMICS: a threshold-free transient shaper (Attack/Sustain), a GLUE compressor whose detector is sidechain-HPF'd ~100 Hz so the sub never pumps it, and a CEILING soft-clip that true-peak-bounds the voice so it can sit hot. Stereo stage: everything <120 Hz is strictly MONO (phase-safe, full excursion); Width spreads only the upper body/click band (M/S) — separate audio_l/audio_r outs with stereoPairs auto-pairing. Inputs: trigger_in (edge-trigger STRIKE — phases reset, envelopes fire), accent_in (per-hit 0..1 CV latched at the strike edge, scaling sweep depth + level), pitch_cv (1V/oct, transposes the whole voice), choke_in (level-sensitive gate — damps while high through a short ramp, releases on the falling edge), PLUS a per-control CV input for every one of the 25 voice knobs (tune_cv … level_cv — each ±1 sweeps its param full-range around the live knob, cvScale matched to the knob curve). Level spans −24..+12 dB with deliberate headroom, guarded by the internal ceiling. Wide 3u banded card: SUB·BODY·CLICK / DRIVE·EQ·TRANSLATE / DYNAMICS·STEREO·OUT. Ships as a clean-deep club kick by default; later DSP phases land inside the worklet without changing this contract (Phase 1 renders SUB+BODY, L=R).

kick drumtrigger_ingateaccent_incvpitch_cvcvchoke_ingatetune_cvcvsub_decay_cvcvsub_level_cvcvpitch_amt_cvcvpitch_time_cvcvtension_cvcvbody_decay_cvcvbody_level_cvcvbody_shape_cvcvclick_len_cvcvclick_tone_cvcvclick_level_cvcvdrive_cvcvhard_cvcvtranslate_cvcvsub_eq_cvcvbody_eq_cvcvattack_eq_cvcvtilt_cvcvattack_cvcvsustain_cvcvglue_cvcvceiling_cvcvwidth_cvcvlevel_cvcvaudio_laudioaudio_raudioaudiocvgatepitch

inputs

trigger_ingateGate signal (rising/falling edge).
accent_incvControl voltage.
pitch_cvcvControl voltage.
choke_ingateGate signal (rising/falling edge).
tune_cvcvCV -> tune param.
sub_decay_cvcvCV -> sub_decay param.
sub_level_cvcvCV -> sub_level param.
pitch_amt_cvcvCV -> pitch_amt param.
pitch_time_cvcvCV -> pitch_time param.
tension_cvcvCV -> tension param.
body_decay_cvcvCV -> body_decay param.
body_level_cvcvCV -> body_level param.
body_shape_cvcvCV -> body_shape param.
click_len_cvcvCV -> click_len param.
click_tone_cvcvCV -> click_tone param.
click_level_cvcvCV -> click_level param.
drive_cvcvCV -> drive param.
hard_cvcvCV -> hard param.
translate_cvcvCV -> translate param.
sub_eq_cvcvCV -> sub_eq param.
body_eq_cvcvCV -> body_eq param.
attack_eq_cvcvCV -> attack_eq param.
tilt_cvcvCV -> tilt param.
attack_cvcvCV -> attack param.
sustain_cvcvCV -> sustain param.
glue_cvcvCV -> glue param.
ceiling_cvcvCV -> ceiling param.
width_cvcvCV -> width param.
level_cvcvCV -> level param.

outputs

audio_laudioAudio signal.
audio_raudioAudio signal.

params

tuneHz20..120(default 50)
pitch_amtst0..48(default 24)
pitch_timems5..120(default 30)
tensionlinear0..0.6(default 0)
sub_decayms50..800(default 450)
body_decayms20..400(default 120)
click_lenms2..60(default 12)
sub_levellinear0..1(default 0.9)
body_levellinear0..1(default 0.7)
click_levellinear0..1(default 0.4)
body_shapelinear0..1(default 0.3)
click_toneHz500..6000(default 2800)
drivelinear0..1(default 0.4)
harddiscrete0..1(default 0)
translatelinear0..1(default 0.3)
sub_eqdB-12..12(default 0)
body_eqdB-12..12(default 3)
attack_eqdB-12..12(default 2)
tiltlinear-1..1(default 0)
attacklinear-1..1(default 0.2)
sustainlinear-1..1(default 0)
gluelinear0..1(default 0.3)
ceilinglinear0..1(default 0.5)
widthlinear0..1(default 0.2)
leveldB-24..12(default 0)
source · kickdrum.ts
lines sources

LINES is a procedural mono-video source that renders soft-edged parallel stripes whose orientation, count, thickness, and scroll you dial in. The shader rotates the UV space by Orient (0 = horizontal lines, 1 = vertical, anything between = diagonal), then computes wave = abs(sin(2pi * Amp * (position + Phase))) along that axis and lights up bright bands wherever the wave falls under the Thickness threshold, with a smoothstep soft edge straddling it. The result is a grayscale grating written equally to all three RGB channels (alpha 1). The pattern auto-scrolls on its own (Phase advances steadily over time, time * 0.15 wrapped to 0..1) so it is visibly alive without touching a knob; your Phase value adds on top of that drift. Patch the OUT into an OUTPUT screen, a video mixer, or a colorizer; use it as a structural test pattern or as a moving modulation texture for downstream video modules.

linesfmmono-videoorientcvampcvthicknesscvphasecvoutmono-videoaudiocvgatepitch

inputs

fmmono-videomono-video
orientcvCV -> orient param.
ampcvCV -> amp param.
thicknesscvCV -> thickness param.
phasecvCV -> phase param.

outputs

outmono-videomono-video

params

orientlinear0..1
amplpx0.5..50
thicknesslinear0..1
phaselinear0..1
fmDepthlinear0..1
source · lines.ts
loopback sources

The BROWSER VIEWPORT as a video source (LOCAL ONLY). Zero inputs, one video OUT whose contents are what you currently SEE in this tab — the visible canvas pane — so you can feed LOOPBACK -> RECORDERBOX to record your viewport, or -> any effect for live self-referential feedback. Mechanism: the current tab is captured via the Screen Capture API (getDisplayMedia({ video: { displaySurface: "browser" }, preferCurrentTab: true, selfBrowserSurface: "include" })), run in a hidden <video>, and the engine samples each frame into a WebGL2 texture exactly like CAMERA; a crop step then windows the tab frame down to the app viewport element's on-screen rectangle (re-measured every frame by a node-scoped pump that outlives any one card mount, and pushed to the engine as LOCAL per-viewer state — never synced) so OUT is just the active viewport, letterbox-fit into the engine frame (black bars, never cropping edges away). Because the preview shows the tab it is captured from, the live preview is intentionally recursive (a video-feedback tunnel). Params: gain (0..2 RGB multiplier), crop (viewport vs whole-tab, ON by default). STARTING A CAPTURE ALWAYS TAKES A CLICK — getDisplayMedia has no already-granted state, so unlike CAMERA nothing can resume a capture automatically: every capture needs a fresh user gesture and a fresh trip through the picker. That gesture is START CAPTURE on the faceplate under the default shell, or the card's Start capture button under ?shell=legacy. A capture ends with STOP or from the browser's own share bar (the module returns to idle with a re-capture button); getDisplayMedia is feature-detected, degrading to a disabled unsupported state with the reason where the API is missing.

loopbackoutvideoaudiocvgatepitch

outputs

outvideovideo

params

gainlinear0..2
cropdiscrete0..1
source · loopback.ts
lush garden sources

LUSH GARDEN — generative layered-garden video SOURCE. Assembles a dense 2D English-garden bed from a bank of plant cutouts (flowers/bushes/small trees, ~70/20/10 spawn mix) on a ground plane running from the bottom edge up to an INVISIBLE horizon (the HORIZON knob moves placement geometry only — no line is ever drawn at it). Plants spawn continuously at RATE spawns/sec, grow in from their ground anchor (~350 ms ease-out), scale down with depth (perspective) on top of the tree > bush > flower kind scale, and composite back-to-front; VIEW pans a viewport across a ~2.5-frame-wide world with depth-proportional 2D parallax (near sweeps, far crawls). At the 350-plant cap each spawn replaces the OLDEST plant so the bed keeps evolving. Patch a gate into GROW and continuous spawning stops — exactly ONE plant grows per rising edge ([GATED] badge); a RESET edge clears the bed. FOUR simultaneous outputs render the same scene: CLEAN (plain composite, the card preview), MONO (white silhouette outlines via an alpha-Sobel baked per cutout), WATERCOLOR (colours bled strictly inside each silhouette), PSYCHEDELIC (animated hue-cycled colours, per-plant phase). An optional BACKGROUND video passes through unprocessed behind the plants on all four outputs. Cutouts load lazily from static/lushgarden (manifest-driven; outline+watercolor baked once per cutout at load so the 4 outputs stay cheap; unconnected outputs are skipped). All ports live on the yellow drill-down PATCH PANEL (no raw side jacks, #767).

lush gardenbackgroundvideoratecvhorizoncvviewcvmonovideowatercolorvideopsychedelicvideocleanvideoaudiocvgatepitch

inputs

backgroundvideovideo
ratecvCV -> rate param.
horizoncvCV -> horizon param.
viewcvCV -> view param.

outputs

monovideovideo
watercolorvideovideo
psychedelicvideovideo
cleanvideovideo

params

ratelog?..?
horizonlinear0..1
viewlinear0..1
fovlinear0..1
freezelinear0..1(default 0)
source · lushgarden.ts

Plaits-style macro oscillator (Mutable Instruments archetype). Clean-room pure-TypeScript implementation — not a port of Plaits' C++ source (see PR #27 for the closed emscripten attempt). First-slice scope ships two synthesis models behind the three canonical macros (HARMONICS / TIMBRE / MORPH): (0) virtual analog (VA) — morphing saw→square→triangle PolyBLEP wave + detuned partner (HARMONICS = detune amount) + wavefolder (TIMBRE = fold amount); (1) waveshape — sine through a morphable wavefolder/tanh-waveshaper (TIMBRE = drive, MORPH = wavefolder↔tanh, HARMONICS = sub-octave mix). PITCH input is V/oct; NOTE param is a ±60-semitone offset on top. TRIG resets phase on rising edge for percussive attack alignment. OUT is the level-scaled main output; AUX is a per-model raw tap (unfolded sub-octave triangle in VA, pre-distortion body in waveshape). More models (granular, FM, chord, speech, kick/snare/hat, modal, etc.) land in follow-up PRs.

macrooscillatorpitchpitchtriggatemodel_cvcvnote_cvcvharm_cvcvtimb_cvcvmorph_cvcvlevel_cvcvoutaudioauxaudioaudiocvgatepitch

inputs

pitchpitchV/oct pitch input (1 unit = 1 octave). Sums with the NOTE param.
triggateGate input — rising edge resets the oscillator phase accumulators for clean percussive attack alignment.
model_cvcvCV → model param (discrete switch: 0=VA, 1=WAVESHAPE).
note_cvcvCV → note param (±60-semitone offset on top of pitch V/oct).
harm_cvcvCV → HARMONICS macro (0..1). In VA: detune amount of the partner voice; in WAVESHAPE: sub-octave sine mix.
timb_cvcvCV → TIMBRE macro (0..1). In VA: wavefolder amount on the summed wave; in WAVESHAPE: waveshaper drive.
morph_cvcvCV → MORPH macro (0..1). In VA: saw→square→triangle wave morph; in WAVESHAPE: wavefolder↔tanh waveshaper crossfade.
level_cvcvCV → LEVEL (0..1) — final scalar on the OUT port (AUX is unaffected).

outputs

outaudioMain audio output, post-LEVEL.
auxaudioAuxiliary output — per-model raw tap: unfolded sub-octave triangle (VA) or pre-distortion body sine (WAVESHAPE). Not LEVEL-scaled.

params

modeldiscrete0..?(default 0)
notest-60..60(default 0)
harmonicslinear0..1(default 0.3)
timbrelinear0..1(default 0.3)
morphlinear0..1(default 0.5)
levellinear0..1(default 0.8)
source · macrooscillator.ts
mandelbulb sources

A WebGL2 ray-marched 3D Mandelbulb fractal source that doubles as an audio oscillator. A single full-screen-quad fragment shader marches the power-8 Mandelbulb distance estimate, shades the hit surface with finite-difference normals, diffuse + Phong specular and a soft shadow, tints it with the Hue palette, and emits the render on video_out (4:3, ray-marched internally at half engine resolution — 512x384 at the 1024x768 default — and LINEAR-upscaled). An orbit camera (Zoom dolly + Rot X pitch / Rot Y yaw) frames the bulb; Power morphs the fractal shape and Detail sets the iteration budget (higher = crisper, costlier). Turn SLICE on to bridge into audio: a fixed-size plane (camera-independent) is marched through the bulb's distance field to read its cross-section as a 256-sample wavetable, played as an oscillator on audio_out and shown as a second on-card readout with a draggable yellow select box. Usage: patch a slow LFO into rotate_y_cv (or just leave SPIN on) for a tumbling fractal, modulate power_cv for shape-morphing, and enable SLICE to play the bulb's geometry as an evolving waveform.

mandelbulbzoom_cvcvrotate_x_cvcvrotate_y_cvcvpower_cvcvdetail_cvcvhue_cvcvslice_y_cvcvslice_rx_cvcvslice_ry_cvcvslice_rz_cvcvvideo_outmono-videoaudio_outaudioaudiocvgatepitch

inputs

zoom_cvcvCV -> zoom param.
rotate_x_cvcvCV -> rotate_x param.
rotate_y_cvcvCV -> rotate_y param.
power_cvcvCV -> power param.
detail_cvcvCV -> detail param.
hue_cvcvCV -> hue param.
slice_y_cvcvCV -> slice_y param.
slice_rx_cvcvCV -> slice_rx param.
slice_ry_cvcvCV -> slice_ry param.
slice_rz_cvcvCV -> slice_rz param.

outputs

video_outmono-videomono-video
audio_outaudioAudio signal.

params

zoomlog0.3..3
rotate_xlinear?..?
rotate_ylinear?..?
powerlinear1..12
detaildiscrete4..30
huelinear0..1
autospindiscrete0..1
screen_ondiscrete0..1
slicediscrete0..1
slice_ylinear?..?
slice_rxlinear?..?
slice_rylinear?..?
slice_rzlinear?..?
freezelinear0..1
source · mandelbulb.ts
marbles sources

Random sampler / clock generator (Mutable Instruments Marbles archetype, Émilie Gillet, MIT-licensed). Clean-room TypeScript port of the eurorack/marbles/ DSP. The T-section (t1 / t2 gates) generates clocked random gates via one of six models — COIN (complementary Bernoulli), CLUSTERS, DRUMS (18 built-in 8-step patterns), INDEP (independent Bernoulli), 3-STATE, MARKOV — with a déjà-vu loop that locks the random stream into a repeating pattern (RATE / T BIAS / T JITTER / DÉJÀ VU / LENGTH). The X-section (x1 / x2 / x3 CV) draws random voltages shaped by SPREAD (variance), X BIAS (mean), and STEPS (quantization amount + STEPS-knob portamento), snapped through a weight-aware variable-resolution quantizer onto one of six scales (C major / C minor / Pentatonic / Pelog / Raag Bhairav / Raag Shri), with its own déjà-vu loop shared across the three X channels via pseudo-random hash shifts. clk is the master clock. CV outs are ±1 (= ±5V). Beta-distribution sampling is approximated analytically vs the firmware's precomputed table; the déjà-vu / Markov / quantizer / lag logic is ported line-for-line.

marblesrate_cvcvtmodel_cvcvtbias_cvcvtjitter_cvcvdejavu_cvcvlength_cvcvspread_cvcvxbias_cvcvsteps_cvcvxdejavu_cvcvscale_cvcvt1gatet2gatex1cvx2cvx3cvclkgateaudiocvgatepitch

inputs

rate_cvcvCV → RATE (internal clock, semitone-scaled).
tmodel_cvcvCV → T MODEL (discrete: 0=COIN, 1=CLUSTERS, 2=DRUMS, 3=INDEP, 4=3-STATE, 5=MARKOV).
tbias_cvcvCV → T BIAS (0..1) — gate-model coin bias.
tjitter_cvcvCV → T JITTER (0..1) — clock timing jitter.
dejavu_cvcvCV → DÉJÀ VU (0..1) — T-section random-loop lock amount.
length_cvcvCV → LENGTH (1..16) — déjà-vu loop length.
spread_cvcvCV → SPREAD (0..1) — X random-voltage variance.
xbias_cvcvCV → X BIAS (0..1) — X random-voltage mean.
steps_cvcvCV → STEPS (0..1) — X quantization amount / portamento.
xdejavu_cvcvCV → X DÉJÀ VU (0..1) — X-section random-loop lock.
scale_cvcvCV → SCALE (discrete 0..5).

outputs

t1gateT1 gate — first Bernoulli/coin/drum gate stream.
t2gateT2 gate — complementary/second gate stream.
x1cvX1 CV — quantized random voltage (±1 = ±5V).
x2cvX2 CV — déjà-vu-shifted random voltage.
x3cvX3 CV — déjà-vu-shifted random voltage.
clkgateMaster clock gate (master ramp < 0.5).

params

ratest-60..60(default 0)
t_modeldiscrete0..?(default 0)
t_biaslinear0..1(default 0.5)
t_jitterlinear0..1(default 0)
deja_vulinear0..1(default 0)
lengthdiscrete1..16(default 8)
pw_meanlinear0..1(default 0.5)
spreadlinear0..1(default 0.5)
x_biaslinear0..1(default 0.5)
stepslinear0..1(default 0.5)
x_deja_vulinear0..1(default 0)
x_lengthdiscrete1..16(default 8)
scalediscrete0..?(default 0)
source · marbles.ts
meowbox sources

Gate-triggered cat-vocal synth voice (formant bank + harmonic + noise excitation).

meowboxgategatepitchpitchmorphcvdecaycvlevelcvLaudioRaudioaudiocvgatepitch

inputs

gategateGate — sounds while high.
pitchpitch1V/oct pitch in (0V = C4).
morphcvCV -> anchor morph.
decaycvCV -> decay.
levelcvCV -> output level.

outputs

LaudioStereo L out.
RaudioStereo R out.

params

pitchsemi-36..36(default 0)
morphlinear0..1(default 0.25)
decays0.05..2(default 0.4)
levellinear0..2(default 1)
source · meowbox.ts
midi lane sources

MIDI LANE — a per-channel "instrument bus" demux for a hardware MIDI sequencer (Reliq, Cre8audio Programm, Empress ZOIA, or any class-compliant USB-MIDI device). DAW-style workflow: assign each track of your sequencer to its own MIDI channel, then drop one MIDI LANE per instrument and point each at that track's channel — multi-timbral = several lanes, like several MIDI-CV-BUDDYs but channel-aware and richer. Each lane demuxes its channel into the CV/gate the rack speaks: pitch_cv (V/oct, 0V = C4 = MIDI 60, pitch-bend summed at ±2 st), gate (HIGH while any key on the lane is held; with RETRIG, dips one audio block on each new note-on so a downstream ADSR re-fires), velocity_cv (0..1), plus TWO learn-assignable CC taps (cc_a / cc_b → 0..1 CV — hit LEARN, wiggle a CC, done; these subsume the per-track CC-modulation lane and can drive audio params OR video params via the cross-domain bridge), plus ONE by-note-number drum gate (note_gate fires on a card-selected MIDI note, default GM kick = 36 — the Programm/Reliq ch10 drum-router pattern generalized via configuration, not 8 fixed ports). MONO mode is monophonic with three voice-priority modes (LAST / LOW / HIGH); POLY mode adds a 10-channel polyPitchGate output (poly) so a chord on the lane plays a polyphonic synth (cartesian / dx7). The SAME outputs drive VIDEO modules for free: a gate or cv handle cabled into ACIDWARP.scene_cv / DOOM.cv_pN fires visuals with no synth voice — the engine's cross-domain CV/gate→video bridge needs no special "video gate" port. Uses the browser's built-in Web MIDI API (no third-party library, no native bridge); click "Connect MIDI…" once per origin to grant access. Main-thread plumbing (ConstantSource-per-output, 2 ms scheduling lookahead) identical to MIDI-CV-BUDDY, whose note logic it reuses verbatim. v1 surfaces a single-channel-or-ALL selector on the card (the engine supports a multi-channel Set under the hood for a future multi-select). End-to-end Web MIDI latency is the honest ~5-10 ms main-thread path.

midi lanepitch_cvcvgategatevelocity_cvcvcc_acvcc_bcvnote_gategatepolypolyPitchGateaudiocvgatepitch

outputs

pitch_cvcvV/oct pitch output (0V = C4 = MIDI 60), the winning held note under the lane's voice priority. Pitch-bend summed in at ±2 semitones. In POLY mode the per-voice pitches go out the `poly` port instead.
gategateGate output. HIGH while any key on the lane's channel(s) is held; with RETRIG on, dips to 0 for one audio block on each new note-on so a downstream ADSR re-fires. MONO mode only (POLY drives per-voice gates on the `poly` port).
velocity_cvcvVelocity CV (0..1, raw MIDI velocity / 127). Updated on each note-on; latched between events.
cc_acvLearn-assignable CC tap A → 0..1 CV. Hit LEARN on the card + wiggle a CC to bind (defaults to CC1 = mod wheel). Drives audio params directly or video params via the cross-domain bridge.
cc_bcvLearn-assignable CC tap B → 0..1 CV. Unassigned by default; hit LEARN + wiggle a CC to bind. Same continuous-modulation role as cc_a.
note_gategateBy-note-number drum gate — fires a one-shot pulse when the card-selected MIDI note (default GM kick = 36) arrives on the lane's channel(s). Cable into a drum voice trigger, or into a video module's gate input to fire visuals with no synth voice.
polypolyPitchGatePolyphonic chord output (10-channel polyPitchGate = 5 pitch/gate pairs). Carries signal only in POLY mode (newest-held voices win under voice pressure, steal-oldest). Patch into a poly synth (cartesian / dx7). Neutral in MONO mode.
source · midi-lane.ts

Hardware MIDI controller → pitch + gate + velocity CV. Uses the browser's built-in Web MIDI API (no third-party library) and converts incoming note-on / note-off / pitch-bend messages into three ConstantSourceNode outputs: pitch_cv (V/oct, 0V = C4 = MIDI 60, with pitch-bend summed in at the MIDI-standard ±2 semitones), gate (0/1), and velocity_cv (0..1). Monophonic with three voice-priority modes (LAST = newest key wins, the conventional default; LOW = lowest key, classic mono-bass behavior; HIGH = highest), a RETRIG toggle that drops the gate to 0 for one audio block between successive note-ons (so a downstream ADSR re-fires) versus legato (gate stays high through key changes), an ALL/1..16 channel filter, and a device-picker dropdown that hot-plugs when controllers connect/disconnect. The user clicks "Connect MIDI…" once per origin to grant permission; subsequent reloads reuse the grant. End-to-end latency is honest about the Web MIDI main-thread path (~5-10 ms typical on Chrome/macOS); event.timeStamp is mapped to ctx.currentTime + a 2 ms lookahead so scheduling lands at the start of the next audio block rather than mid-block.

midi-cv-buddypitch_cvcvgategatevelocity_cvcvaudiocvgatepitch

outputs

pitch_cvcvV/oct pitch output (0V = C4 = MIDI 60). Pitch-bend is summed in at the MIDI-standard ±2 semitones each side.
gategateGate output. HIGH while any key is held; with RETRIG on, dips to 0 for one audio block on each new note-on so a downstream ADSR re-fires.
velocity_cvcvVelocity CV (0..1, raw MIDI velocity / 127). Updated on each note-on; latched between events.
source · midi-cv-buddy.ts
midiclock sources

Hardware MIDI transport bridge. Locks to a MIDI device and surfaces the System Real-Time stream as gate/CV: clock (gate) at a user-selectable subdivision — 24=quarter (default, patch directly into TIMELORDE.clock to slave it to the external transport), 12=eighth, 6=sixteenth, 3=32nd, 1=raw 24 PPQN; run (cv, 0/1) tracks transport state; midistart + midistop fire one-shot gates on MIDI Start (0xFA) and Stop (0xFC). Continue (0xFB) raises run without re-firing midistart, so downstream loops resume in place. Channel-voice messages are ignored — pair with MIDI-CV-BUDDY for note/velocity. Same Web MIDI / ConstantSource / 2 ms lookahead plumbing as MIDI-CV-BUDDY.

midiclockclockgateruncvmidistartgatemidistopgateaudiocvgatepitch

outputs

clockgateGate. Rising edge every N incoming MIDI clock ticks; N selectable as 24 (quarter, default) / 12 (eighth) / 6 (sixteenth) / 3 (32nd) / 1 (raw 24 PPQN). Patch into TIMELORDE.clock to slave it to the external transport.
runcvCV. 0 while transport is stopped, 1 while running. Latched. MIDI Continue (0xFB) raises this to 1 without re-firing midistart.
midistartgateOne-shot gate. Fires on MIDI Start (0xFA). Continue (0xFB) does NOT fire this — it raises run only.
midistopgateOne-shot gate. Fires on MIDI Stop (0xFC).
source · midiclock.ts
milkdrop sources

MILKDROP — a Winamp/Milkdrop music visualizer (wrapping the open-source butterchurn WebGL2 engine + ~20 curated classic presets) as a fully CV-instrumented video SOURCE. Patch audio into AUDIO and the visuals react (the tap is inaudible). The novel part: butterchurn drives nearly all preset motion from three audio scalars — bass/mid/treb — and MILKDROP lets a cable REPLACE any of them. Patch CV into BASS/MID/TREB to drive that band from the cable instead of the live audio (an unpatched band still follows the audio); REACT scales all three. SPEED time-warps the engine clock (clamped at 0), PRESET selects the active preset (quantized knob/CV), MORPH sets the crossfade seconds, and a rising edge on NEXT advances presets hands-free. OUT is a normal downstream video texture (route into a mixer / keyer / OUTPUT). The card has a live preview + preset name/index readout + RCT/SPD/PST/MPH knobs, and hide-controls turns it into a resizable monitor. The butterchurn engine lives in node_modules (not vendored into the WebGL attest basis) and the preset pack loads behind a dynamic import() as a separate chunk. All ports live on the yellow drill-down PATCH PANEL (no raw side jacks, #767).

milkdropaudioaudiobasscvmidcvtrebcvreactivitycvspeedcvpresetSelectcvmorphcvnextgateoutvideoaudiocvgatepitch

inputs

audioaudioAudio signal.
basscvCV -> bass param.
midcvCV -> mid param.
trebcvCV -> treb param.
reactivitycvCV -> reactivity param.
speedcvCV -> speed param.
presetSelectcvCV -> presetSelect param.
morphcvCV -> morph param.
nextgateGate signal (rising/falling edge).

outputs

outvideovideo

params

basslinear0..2
midlinear0..2
treblinear0..2
reactivitylinear0..2
speedlinear0..2
presetSelectlinear0..?
morphlinear0..8
nextTriglinear0..1
source · milkdrop.ts
mirrorpool sources

MIRRORPOOL — a WebGL2 VIDEO source rendering a hemisphere pool of liquid inside a box, viewed by a full-PTZ camera you fly around within it. TWO video inputs feed the optics: POOL is surface-mapped to the INSIDE of the hemisphere (the underwater view you see refracted through the water, with Beer-Lambert depth absorption + chromatic dispersion) and SCENE is the surroundings, reflected off the surface as an overhead backdrop (projected to the box ceiling so a camera pan slides a RECOGNISABLE reflection, not a lat-long smear). A single REAL height field drives all the optics — not a flat normal-map fake: WIND raises a set of 4 directional swell waves whose amplitude grows with wavelength (dispersion omega=sqrt(g*k), so bigger crests are genuinely TALLER and travel FASTER), and RAIN runs a seeded Poisson scheduler spawning raindrop impacts that punch one-shot dimples which expand into propagating rings — sparse shallow drizzle up to a dense deep downpour. The surface NORMAL reconstructed from that height field (by finite differences, one consistent sign convention shared by the sim + swell so they never cancel) drives a physically-based Schlick FRESNEL split (water F0=0.02, eta=1/1.33). In the default REFRACT mode (MODE=0) you see the reflected scene layered over the refracted, caustic-lit pool beneath; sweep MODE toward MIRROR (1) and the surface becomes a near-full mirror of the sky/scene that the ripple normals shatter and distort — one continuous CV-friendly scalar, no branch. BRIGHT is a virtual sun scaling overall scene light uniformly (no sun disc drawn yet). The camera is a repositionable ORBIT + FREE-LOOK rig surfaced as the card's TWO X-Y pads: pad 1 POSITIONS the eye on a sphere around the pool (Orbit = azimuth around it, Elev = elevation from straight overhead down BELOW the water surface, plus a Dist dial), and pad 2 is the free-LOOK offset (Look X = yaw, Look Y = pitch) off the default aim-at-centre so the view can point any direction; Zoom sets a 70..20 degree FOV. Dropping the elevation below the surface flips the render into an underwater Snell-window path (a bright refracted cone of the sky/scene overhead, ringed by total-internal-reflection of the pool interior). Every control has a matching CV input (port id == param id + `_cv`), so patch an LFO into orbit_az_cv for a slow orbit, noise into rain_cv to gust the storm, or an envelope into surface_mode_cv to melt between a clear pool and a hard mirror. The rain wave sim runs as a float ping-pong wave-equation FBO when the GPU exposes renderable float targets, and falls back to an analytic expanding-ring model in the render shader when it does not (isFloat=false, e.g. some SwiftShader configs) so rain is never a dead field. Rendered at half engine resolution and LINEAR-upscaled (the mandelbulb perf discipline). With nothing patched it still renders a live procedural sky + rippling water, so it doubles as a standalone generative source. All ports live on the yellow drill-down PATCH PANEL (no raw side jacks). The pure physics (Fresnel / swell gradients / normal reconstruction / Poisson rain / orbit + free-look camera) is unit-tested in $lib/video/mirrorpool-core (the exact CPU mirror of the shader).

mirrorpoolpoolvideoscenevideowind_speed_cvcvwind_dir_cvcvrain_cvcvbrightness_cvcvsurface_mode_cvcvorbit_az_cvcvorbit_el_cvcvorbit_dist_cvcvlook_yaw_cvcvlook_pitch_cvcvzoom_cvcvvideo_outvideoaudiocvgatepitch

inputs

poolvideovideo
scenevideovideo
wind_speed_cvcvCV -> wind_speed param.
wind_dir_cvcvCV -> wind_dir param.
rain_cvcvCV -> rain param.
brightness_cvcvCV -> brightness param.
surface_mode_cvcvCV -> surface_mode param.
orbit_az_cvcvCV -> orbit_az param.
orbit_el_cvcvCV -> orbit_el param.
orbit_dist_cvcvCV -> orbit_dist param.
look_yaw_cvcvCV -> look_yaw param.
look_pitch_cvcvCV -> look_pitch param.
zoom_cvcvCV -> zoom param.

outputs

video_outvideovideo

params

wind_speedlinear0..1
wind_dirlinear?..?
rainlinear0..1
brightnesslinear0..2
surface_modelinear0..1
orbit_azlinear?..?
orbit_ellinear-1.45..1.45
orbit_distlinear0.4..5
look_yawlinear?..?
look_pitchlinear-1.45..1.45
zoomlinear0..1
freezelinear0..1
source · mirrorpool.ts
nibbles sources

A playable QBasic-Nibbles snake game rendered as a patchable video source. The classic snake roams an 80x50 grid (CPU-rasterised to a 320x200 frame with a gentle CRT scanline darken) eating one pellet at a time, growing its body, and dying on a wall or self collision. Drive it two ways: click the card to focus it and steer with the arrow keys, or flip AUTO on to let the built-in greedy bot self-play (it walks toward the pellet, avoiding its own tail, with no foresight so it eventually traps and dies — then auto-restarts). The game advances at the rate set by Tick. Beyond the video frame, the snake's life becomes control voltage and sound: gate pulses fire on pellet/death/direction-change, a length CV tracks how long the snake has grown, and two square-wave audio outs are pitched by the snake's length (length 4 = A2/110 Hz, every +12 length = +1 octave). Patch the gates into envelopes/triggers and the length CV into pitch or filter cutoff to sonify the game. The card also has a RESET button, a 1x-4x zoom button, and a live LEN readout (a dagger appears when the snake is dead). The card's game screen is resizable: the on-card scale button cycles the 320x200 source through 1x / 2x / 3x / 4x zoom (image-rendering: pixelated, so it stays crisp); the knobs, buttons, and patch jacks stay fixed-size while only the screen grows.

nibblesoutvideopelletgatedeathgatedir_changegatelength_cvcvsnakeaudiogatedaudioaudiocvgatepitch

outputs

outvideovideo
pelletgateGate signal (rising/falling edge).
deathgateGate signal (rising/falling edge).
dir_changegateGate signal (rising/falling edge).
length_cvcvControl voltage.
snakeaudioAudio signal.
gatedaudioAudio signal.

params

autodiscrete0..1
tick_mslinear40..200
source · nibbles.ts
noise sources

Basic noise source. Three independent audio outputs — WHITE (full-spectrum), PINK (1/f, -3 dB/oct via Voss-McCartney), BROWN (leaky-integrated white: flat below a ~77 Hz corner at 48 kHz, -6 dB/oct above it). All outputs share a single LEVEL knob, which is one multiplier and not one loudness — brown leaves 7.1 dB and pink 12.3 dB below white. No CV inputs.

noisewhiteaudiopinkaudiobrownaudioaudiocvgatepitch

outputs

whiteaudioWhite noise output (audio-rate). Flat spectrum, Math.random()-driven; std-dev ≈ 0.577 × LEVEL.
pinkaudioPink noise output (audio-rate). 1/f spectrum (-3 dB/oct) via Voss-McCartney. Sounds "warmer" than white.
brownaudioBrown noise output (audio-rate). 1/f² spectrum (-6 dB/oct) via leaky-integrated white. Sounds like distant ocean / rumble.

params

levellinear0..1(default 0.5)
source · noise.ts
numpad+ sources

Numpad-driven 4-layer × 16-step sequencer + live keyboard. Each numpad note key fires the active layer's pitch+gate immediately AND, when REC ARM (one-pass record on next play-from-start) or OVERDUB (always-recording) is on, writes the note to the nearest step on the active layer. Default keymap: 1=C, 2=C#, 3=D, 4=D#, 5=E, 6=F, 7=F#, 8=G, 9=G#, 0=A, /=A#, *=B, with Numpad+ / Numpad- bound to OCTAVE UP / OCTAVE DOWN. All fourteen bindings are REMAPPABLE to any physical key — left-click a key cap on the faceplate (or right-click for the Remap / Reset menu) and press the key you want — and the map is saved with the patch, per node. Octave 0-8 (named c0..c8 by the note the first key plays) also moves from the faceplate. CV inputs: clock (rising-edge external clock — internal BPM ignored while patched) + layer (unipolar 0..1 CV selecting the active layer, otherwise the activeLayer param wins). CV outputs: l1_pitch / l1_gate ... l4_pitch / l4_gate so a patch can route each layer to its own downstream synth — basically a 4-track sequencer — plus a POLY bus carrying the active layer's voices for a poly-aware voice, NINE outputs in total. When this module exists in the rack its keyboard listener captures whatever event.codes its keymap binds and preventDefaults them, so other modules never see those keys; text fields and a focused DOOM card are excluded. The listener lives in the module itself rather than on any card, so it works with no UI open.

numpad+clockgatelayercvl1_pitchpitchl1_gategatel2_pitchpitchl2_gategatel3_pitchpitchl3_gategatel4_pitchpitchl4_gategatepolypolyPitchGateaudiocvgatepitch

inputs

clockgateGate signal (rising/falling edge).
layercvControl voltage.

outputs

l1_pitchpitchV/oct pitch CV.
l1_gategateGate signal (rising/falling edge).
l2_pitchpitchV/oct pitch CV.
l2_gategateGate signal (rising/falling edge).
l3_pitchpitchV/oct pitch CV.
l3_gategateGate signal (rising/falling edge).
l4_pitchpitchV/oct pitch CV.
l4_gategateGate signal (rising/falling edge).
polypolyPitchGatepolyPitchGate

params

bpmlinear30..300(default 120)
isPlayingdiscrete0..1(default 0)
activeLayerdiscrete0..3(default 0)
recArmdiscrete0..1(default 0)
overdubdiscrete0..1(default 0)
octavediscrete?..?(default 4)
polydiscrete0..1(default 0)
source · numpad-plus.ts
outlines sources

OUTLINES — stateful particle video generator (LZX-style primitive source; formerly CIRCLES, renamed when the SHAPE selector landed). A GATE event (or the internal RATE clock) spawns a SHAPE at a SEEDED-random position in a 1024-px field; each shape latches its diameter / vector / speed / decay / SHAPE at spawn and moves in that direction, BOUNCING when its CENTER-POINT hits a wall (the velocity reflects; no edge/radius collision math for the WALL, so a fat shape may briefly overhang). SHAPE picks one of six forms — circle, triangle, square, pentagon, hexagon, octagon — each polygon a REGULAR N-gon inscribed in the diameter (every vertex on the circle of radius d/2 — the circumradius), so all six share one bounding-circle radius (d/2) and the COLLIDE math is unchanged across shapes. ROTATION is a LIVE GLOBAL bipolar spin: knob CENTER = no rotation, left extreme = fast CCW, right extreme = fast CW; every live shape shares one rotation angle that accumulates by that angular velocity each frame, so the whole field spins coherently and the spin shows up consistently in the rendered geometry AND in every output (the rotated polygon vertices drive the overlap-count the outputs read; a circle is rotation-invariant so only the 5 polygons visibly turn). With the COLLIDE gate HIGH, shapes ALSO bounce off EACH OTHER: a bounding-circle elastic collision — two shapes collide when the distance between their CENTERS ≤ (r1 + r2), i.e. their circumcircles touch (unlike the center-based wall bounce, this uses the radii), and an equal-mass ELASTIC response swaps the velocity components along the center-to-center normal and separates the pair so they don't stick (each keeps its independent latched SPEED as far as elastic physics allows). Gate LOW / unpatched → shapes PASS THROUGH each other (the default). COLLIDE is a LIVE GLOBAL mode (read every frame), NOT spawn-latched. The inter-shape pass is O(n²) over the active list, bounded by the 200-shape cap (~10k pair tests/frame). Every per-shape property is LATCHED at spawn from the live knob+CV — crucially SPEED and SHAPE: a shape integrates from its OWN latched velocity (and keeps its own latched form) for its whole life, so turning SPD or SHAPE after a shape exists affects ONLY newly-spawned shapes, never the ones already flying. Model: a JS list of active shapes {x,y,vx,vy,diameter,decayS,ageS,alpha,shape,sides,baseAngle} integrated on the engine rAF. Controls — D: DIAMETER (5..270 px, the circumdiameter); V: spawn VECTOR ANGLE (full range = 0..360°, every angle reachable); SPD: SPEED (0 = static scatter, up to 300 px/s ≈ crosses the field in ~3 s; latched independently per shape); DECAY: per-shape FADE-OUT time — 0 = NO decay (the shape PERSISTS, the static-field case, FIFO-capped) ramping up to a 10 s fade where the shape's alpha ramps 1 → 0 and it is removed; SHAPE: the 6-way form selector (circle / triangle / square / pentagon / hexagon / octagon), quantised + latched per shape at spawn; ROT: the bipolar live-global spin (center = still, ± = CW/CCW); RATE: KNOB-ONLY internal clock (0 = spawn ONLY on gate events; turning up spawns faster, hard-capped at 1 shape / 500 ms). Inputs — gate (a rising edge spawns one shape), collide (a LIVE gate: HIGH = shapes bounce off each other elastically, LOW/unpatched = pass through), d / v / spd / decay / shape / rotation (per-param CV; shape latches at spawn, rotation is the live-global spin), video (sampled by the mapped output). Outputs (4, all derived from a per-pixel overlap-COUNT of the active shapes — using the rotated polygon coverage — each shape's contribution scaled by its DECAY fade alpha so a fading shape counts less / draws lighter): OVERLAP (mono-video) white wherever ≥1 shape covers the pixel (dimming as the covering shape fades), black else; CONTOUR (mono-video) shape OUTLINES only, ring width = 10% of that shape's diameter (min 2 px) so many shapes read as "ripples in a pond" (rings lighten as they decay); COMBINE (colour video) the overlap region colourized by overlap COUNT through a hue ramp (1 overlap = one hue; 2,3,4… cycle the spectrum) with brightness + saturation rising as more shapes stack and dimming as the stack fades; MAPPED (colour video) shows the VIDEO input's contents wherever ≥2 shapes overlap, black elsewhere. Bounded sim: shapes bounce forever and accumulate, so a hard cap of 200 active shapes culls the OLDEST first (a safety net even with DECAY) to keep per-frame cost bounded. Determinism: the random spawn position + each shape's seeded initial rotation angle come from a seeded mulberry32 PRNG (fixed default seed; never Math.random), so VRT / per-port / behavioral sweeps are reproducible. Usage: patch a clock/sequencer GATE in (or just turn RATE up) and route OVERLAP / CONTOUR to a SCOPE or mono consumer, COMBINE to OUTPUT for the coloured stack, and a video source → VIDEO in + MAPPED → OUTPUT to punch that source through the ≥2-overlap region. Pick a SHAPE for the spawn (polygons + ROTATION give kaleidoscopic spinning-outline fields), leave DECAY at 0 for an accumulating static field or turn it up for a trail/dissolve look, and gate the COLLIDE input HIGH (any clock/gate/LFO over the high threshold) to switch the field from a soft overlapping wash into a billiards-like cluster where the shapes knock each other around.

outlinesdcvvcvspdcvdecaycvshapecvrotationcvvideovideooverlapmono-videocontourmono-videocombinevideomappedvideoaudiocvgatepitch

inputs

dcvCV -> d param.
vcvCV -> v param.
spdcvCV -> spd param.
decaycvCV -> decay param.
shapecvCV -> shape param.
rotationcvCV -> rotation param.
videovideovideo

outputs

overlapmono-videomono-video
contourmono-videomono-video
combinevideovideo
mappedvideovideo

params

dlinear0..1
vlinear0..1
spdlinear0..1
decaylinear0..1
shapelinear0..1
rotationlinear0..1
ratelinear0..1
freezelinear0..1(default 0)
source · outlines.ts
painter sources

PAINTER — an MS-Paint-style drawing surface as a video SOURCE. The card is a tiny Windows-95 Paint: a tool grid (PENCIL = hard 1px, BRUSH = round sized stroke, ERASER = paints the background colour, LINE, RECT, ELLIPSE, FILL = flood fill, EYEDROPPER = pick a colour off the canvas, TEXT = stamp a string), the classic 28-colour Win95 palette (left-click a swatch = FOREGROUND, right-click = BACKGROUND), a SIZE slider (brush/line width 1..48), a FILL toggle (outline vs background-filled rect/ellipse), and an engine-resolution drawing canvas. Whatever you paint is the single video OUTPUT in real time: the card binds its live canvas to the module once and the engine uploads that canvas every frame (a 1:1 mapping — the canvas IS the frame). MODEL: the drawing is a Y.Doc-synced ordered op log (node.data.ops) — each committed stroke / shape / fill / text appends one PaintOp; on mount and on any remote edit the card REPLAYS the log onto the canvas (deterministic, pure painter-draw.ts), so every rack-mate paints the same picture. Tool / colour / brush-size are LOCAL per-collaborator (only the drawing syncs). UNDO pops the last op; CLEAR empties the log to a blank white page. IO — Inputs: none (a pure source). Output: out (video) — the painted canvas at the engine output resolution. The OUT port lives in the card's yellow drill-down PATCH PANEL (no raw side jacks, #767 standard). A freshly-spawned node renders a blank WHITE page (MS-Paint's default), so it is never a dead black frame. USAGE: paint a logo / title card / doodle and route OUT into a mixer / keyer / effect / OUTPUT; collaborate on one canvas in a shared rack.

painteroutvideoaudiocvgatepitch

outputs

outvideovideo
source · painter.ts
peakstate sources

peakstate is a self-running mandala/kaleidoscope generator — a video SOURCE with no video input. An internal "pen" traces a deterministic drifting Lissajous path (penAtTime: x = 0.5·cos(0.7t), y = 0.5·sin(1.3t + 0.4·cos(0.3t))) through a centred unit disc, pushing one sample per frame into a 600-sample ring buffer (~10s of comet trail). Each frame the whole trail is redrawn once per kaleidoscope arm — rotated by 2π/complexity and mirrored about the arm axis — over a translucent black overlay that decays the previous frame, giving the classic mirror-arm bloom. MOVE + OBLONG add a slow spirograph orbit of the mandala's centre (period ~20s at Speed 1): MOVE sets orbit radius, OBLONG squashes the orbit's vertical extent from a circle toward a near-horizontal "rolling tube". The module emits three coherent views of the SAME pen trail with different palette/transform. Usage: drop it in for a generative kaleidoscope bloom, patch an LFO or envelope into the CV jacks to pulse the speed/arm-count/hue, and pick the mono, full-colour, or pseudo-3D output to suit the look.

peakstatespeed_cvcvcomplexity_cvcvcolor_speed_cvcvmono_outmono-videorgb_outvideoout_3dvideoaudiocvgatepitch

inputs

speed_cvcvCV -> speed param.
complexity_cvcvCV -> complexity param.
color_speed_cvcvCV -> color_speed param.

outputs

mono_outmono-videomono-video
rgb_outvideovideo
out_3dvideovideo

params

speedlinear0.1..4
complexitydiscrete4..32
color_speedlinear0..4
movelinear0..1
oblonglinear0..1
source · peakstate.ts
peertube sources

PEERTUBE — federated-video SOURCE. Search the open PeerTube fediverse, pick a video, and its picture streams in as a CLEAN (untainted) WebGL video texture plus stereo audio — a real downstream-usable source, NOT play-only. MODEL: a debounced search box queries Sepia Search (sepiasearch.org, the official PeerTube meta-index — CORS-open + anonymous, NO proxy needed); results list title, channel@host, duration, a LIVE badge, and a thumbnail. Click a result → the card fetches that video's per-instance public API (https://<host>/api/v1/videos/{uuid}) and resolves a playable stream: it PREFERS the HLS master playlist (streamingPlaylists[0].playlistUrl → attached via hls.js for adaptive playback) and FALLS BACK to the highest-resolution progressive MP4 (files[].fileUrl, attached as a plain <video src>). The stream attaches to a card-owned <video crossorigin="anonymous"> → the engine samples it into the FBO (the `video` output) + taps stereo audio (audio_l / audio_r via MediaElementSource → ChannelSplitter, with the shared keep-alive so an unpatched source keeps decoding at full rate). WHY THE TEXTURE + AUDIO ARE CLEAN (verified): PeerTube sends Access-Control-Allow-Origin:* on the FINAL media hop (master .m3u8 + the fragmented-mp4 / mpeg-ts segments) under a favorable `credentialless` COEP posture, so a crossorigin <video> fed by hls.js both PLAYS and yields an untainted texture — unlike archive.org video (play-only). IO — Inputs: play_trigger (gate, edge=trigger — a rising edge toggles play/pause), next_trigger (gate, edge=trigger — a rising edge loads the next search result, wrapping). Outputs: video (the live frame texture), audio_l / audio_r (stereo, silent ConstantSource placeholders until a stream attaches), loaded (trigger — one pulse when a new video finishes loading), ended (trigger — pulses when the video reaches its end), playing (gate — HIGH while actually playing), playhead (CV — 0..1 normalized position). CV/PATCHING: all inputs + outputs live in the card's yellow drill-down PATCH PANEL (top-left/top-right affordances → INPUT/OUTPUT → grouped Gates / CV / Audio / Video rows) — there are NO raw side jacks (#767 standard). Trigger inputs are main-thread edge-detected the established video-module way (a single bridge-written cv-param read per tick — never a whole-AnalyserNode rescan). USAGE: type a term, press Enter (or wait for the debounce), pick a video, and route VIDEO into a mixer/keyer/OUTPUT and audio_l/audio_r into AUDIO OUT or a SCOPE/SYNESTHESIA for audio-reactive visuals; clock the next_trigger from a sequencer to channel-surf the fediverse. GRACEFUL: ~1/6 instances misconfigure CORS (raw S3 with no ACAO) → the element taints / the HLS load fails fatally → the card degrades to "display unavailable", surfaces a clear status, and AUTO-SKIPS to the next result (it never crashes, taints the texture, or hangs on loading). An optional instance field biases attribution display. Only { instanceHost, uuid, name, selectedHost } persist on the node + sync to rack-mates (everyone resolves + plays the same video locally); transient playback state stays render-local (never a per-frame synced-store write). The AUDIO TRAP: the <video> is created muted for autoplay, then un-muted ONLY after the MediaElementSource tap succeeds, so audio routes into WebAudio without native speaker double-output. LEGAL: federated PUBLIC videos, not hosted by patchtogether — an in-card disclaimer + attribution to PeerTube + Sepia Search ship with it.

peertubeplay_triggergatenext_triggergatevideovideoaudio_laudioaudio_raudioloadedgateendedgateplayinggateplayheadcvaudiocvgatepitch

inputs

play_triggergateGate signal (rising/falling edge).
next_triggergateGate signal (rising/falling edge).

outputs

videovideovideo
audio_laudioAudio signal.
audio_raudioAudio signal.
loadedgateGate signal (rising/falling edge).
endedgateGate signal (rising/falling edge).
playinggateGate signal (rising/falling edge).
playheadcvControl voltage.

params

gainlinear0..2
cv_play_triggerlinear0..1(default 0)
cv_next_triggerlinear0..1(default 0)
source · peertube.ts

Five-voice polyphonic analog-style synth. A POLY input (the polyPitchGate chord bus from MIDI LANE / POLYSEQZ / a chord sequencer) drives five band-limited VCO voices — lane i → voice i — each with TUNE (±36 st) / FINE (±100 ¢) / exponential FM / through-phase PM / pulse width and a continuous tri→saw→square WAVE morph. Each voice has its own gated amplitude envelope, but the A/D/S/R is SHARED across all five voices (one device-level ADSR; aligned with CUBE / WAVECEL / DX7); the gate edge comes from that voice's poly lane, and a released voice holds the played pitch through its release tail. The five post-envelope voices sum through a stereo mixer (per-voice LEVEL + equal-power PAN) and an embedded multimode filter — a continuous LP→BP→HP→Notch MODE dial on a TPT state-variable filter (CUTOFF / RESONANCE) with a WET/DRY bypass — to the stereo OUT_L / OUT_R pair. Each voice is also tapped pre-mixer (post-envelope) to a VOICE1..VOICE5 mono output, and each voice has its own audio-rate FM jack (fm1..fm5) that feeds both its FM and PM depths. 48 panel params (5 voices × 8 + 4 shared ADSR + 4 filter). DSP is own-code: a clean-room polyBLEP band-limited oscillator, a Cytomic/Zavalishin TPT state-variable filter, and a linear-ADSR envelope — not a port of any copyleft source (permissive only).

pentemelodicapolypolyPitchGatefm1audiofm2audiofm3audiofm4audiofm5audioout_laudioout_raudiovoice1audiovoice2audiovoice3audiovoice4audiovoice5audioaudiocvgatepitch

inputs

polypolyPitchGate5-lane poly pitch/gate chord bus (from MIDI LANE / POLYSEQZ / a chord sequencer). Lane i drives voice i (fixed 1:1 mapping); each lane gates that voice's ADSR.
fm1audioAudio-rate FM/PM modulator for voice 1 (drives both the exponential FM and through-phase PM depths set by voice 1's FM / PM faders).
fm2audioAudio-rate FM/PM modulator for voice 2 (depths set by voice 2's FM / PM faders).
fm3audioAudio-rate FM/PM modulator for voice 3 (depths set by voice 3's FM / PM faders).
fm4audioAudio-rate FM/PM modulator for voice 4 (depths set by voice 4's FM / PM faders).
fm5audioAudio-rate FM/PM modulator for voice 5 (depths set by voice 5's FM / PM faders).

outputs

out_laudioStereo mix output, left (post-mixer, post-filter, post-master-gain).
out_raudioStereo mix output, right (post-mixer, post-filter, post-master-gain).
voice1audioVoice 1 pre-mixer mono tap (post-ADSR, before LEVEL/PAN).
voice2audioVoice 2 pre-mixer mono tap (post-ADSR, before LEVEL/PAN).
voice3audioVoice 3 pre-mixer mono tap (post-ADSR, before LEVEL/PAN).
voice4audioVoice 4 pre-mixer mono tap (post-ADSR, before LEVEL/PAN).
voice5audioVoice 5 pre-mixer mono tap (post-ADSR, before LEVEL/PAN).

params

attacks0.001..5(default 0.001)
decays0.001..5(default 0.1)
sustainlinear0..1(default 1)
releases0.001..5(default 0.005)
cutoffHz20..20000(default 1000)
resonancelinear0..0.99(default 0.2)
modelinear0..1(default 0)
wetdrylinear0..1(default 1)
source · pentemelodica.ts
picturebox sources

Image-file SOURCE with a 7-SLOT ASSET SELECTOR. Click "Choose image…" to load a single picture (downscaled to 1024×768, JPEG-encoded, base64 → node.data and synced to all rack-mates; each peer decodes it back into the WebGL2 source texture). A GAIN knob (CV-modulatable, 0..2) scales the output RGB; output `out` is a video-domain image source. ASSET SELECTOR: right-click the card to open "Load multiple…", a 7-row panel where each row is labelled with a note (C D E F G A B) and loads its own image into one of 7 slots (all 7 base64 images sync + all 7 textures stay resident in GPU memory). A clip player (or any pitch + gate source) then SWITCHES which slot is displayed: patch the clip player's GATE output → ASSET GATE and its PITCH output → ASSET PITCH. On each ASSET GATE rising edge the module reads ASSET PITCH (raw V/oct), maps it to a slot by PITCH CLASS (octave-independent), and instantly shows that slot if it holds an image. THE 7-NOTE → SLOT TABLE (the default clip's in-key rows, C-major from C3): C3 (MIDI 48) → slot 1, D3 (50) → slot 2, E3 (52) → slot 3, F3 (53) → slot 4, G3 (55) → slot 5, A3 (57) → slot 6, B3 (59) → slot 7. Matching is by pitch class, so a C in ANY octave selects slot 1, a B in any octave selects slot 7, etc. A pitch whose class is a black key (C# D# F# G# A#) maps to NO slot → the event is IGNORED (the current image keeps showing). The displayed selection is LOCAL render state (every peer computes it from the same synced gate + synced images), so it is never written to the Y.Doc per gate event. ASSET PITCH/ASSET GATE + GAIN live in the card's yellow drill-down PATCH PANEL (no raw side jacks, #767 standard). Limits: 8 PICTUREBOX per workspace.

pictureboxgaincvasset_pitchpitchasset_gategateoutimageaudiocvgatepitch

inputs

gaincvCV -> gain param.
asset_pitchpitchV/oct pitch CV.
asset_gategateGate signal (rising/falling edge).

outputs

outimageimage

params

gainlinear0..2
asset_pitchlinear-10..10(default 0)
asset_gatelinear0..1(default 0)
source · picturebox.ts
rings sources

Modal / sympathetic-string resonator (Mutable Instruments Rings archetype). Faithful TypeScript port of the eurorack/rings/ DSP (MIT-licensed). v1 ships two resonator models: (0) MODAL — bank of 24 parallel stiffness-stretched RBJ bandpasses with cosine-weighted Odd/Even pickup taps; (1) SYMPATHETIC — 2 parallel Karplus-Strong delay lines with one-pole damping. STRUCTURE/BRIGHTNESS/DAMPING/POSITION are the canonical Rings knobs; LEVEL is a soft-limited output gain. EXCITER in drives both engines; STRUM rising edge re-ignites a ~10ms noise burst (KS) or impulse (modal). Outputs odd / even — patch both for stereo. Polyphony 1; STRING+REVERB deferred.

ringsinaudiopitchpitchstrumgatemodel_cvcvnote_cvcvstr_cvcvbright_cvcvdamp_cvcvpos_cvcvlevel_cvcvoddaudioevenaudioaudiocvgatepitch

inputs

inaudioAudio exciter — drives the resonator(s).
pitchpitchV/oct pitch input.
strumgateGate — rising edge re-ignites burst (KS) or impulse (modal).
model_cvcvCV → model (discrete: 0=MODAL, 1=SYMPATHETIC).
note_cvcvCV → note (±60-semitone offset).
str_cvcvCV → STRUCTURE (0..1).
bright_cvcvCV → BRIGHTNESS (0..1).
damp_cvcvCV → DAMPING (0..1). Low = long ring; high = fast decay.
pos_cvcvCV → POSITION (0..1).
level_cvcvCV → LEVEL (0..1) — soft-limited output gain.

outputs

oddaudioPrimary output — odd-indexed mode sum (MODAL) or odd-tap string mix (SYMPATHETIC).
evenaudioSecondary output — even-indexed mode sum / even-tap mix.

params

modeldiscrete0..?(default 0)
notest-60..60(default 0)
structurelinear0..1(default 0.25)
brightnesslinear0..1(default 0.5)
dampinglinear0..1(default 0.5)
positionlinear0..1(default 0.5)
levellinear0..1(default 0.8)
source · rings.ts
samsloop sources

Loop-based sample player. Upload an audio file (≤2 MB — wav / mp3 / m4a / ogg / flac / opus) or record from patched audio inputs in place; the clip is decoded to mono and played back from a fractional read-cursor with linear interpolation, so a single rate control covers varispeed including reverse. IDLE-BY-DEFAULT: a freshly loaded sample sits SILENT and does NOT auto-play — and a saved patch reloads idle too. Playback is started by a TRIGGER, which is MODE-AWARE: in one-shot mode (1-SHOT) a trigger plays the sample through once then returns to silence; in loop mode (LOOP) a trigger starts looping (a re-trigger restarts from the window edge). The trigger comes from BOTH the TRIG gate input (a rising edge) AND the on-card TRIGGER button (a momentary pulse to the worklet that works whether or not a cable is patched into TRIG). The RATE slider spans −2 (reverse 2×) through +1 (forward unity, the centered no-op) to +2 (forward 2×), and a rate CV input sums on top (±1 V = ±100%). START / END faders set the playback window. Holds exactly one sample at a time — a new upload or recording replaces the previous buffer (no playlist, no slots), which keeps the per-instance memory ceiling deterministic.

samslooptriggaterate_cvcvstart_cvcvend_cvcvaudio_l_inaudioaudio_r_inaudiooutaudioaudiocvgatepitch

inputs

triggateGate signal (rising/falling edge).
rate_cvcvCV -> rate param.
start_cvcvCV -> start param.
end_cvcvCV -> end param.
audio_l_inaudioAudio signal.
audio_r_inaudioAudio signal.

outputs

outaudioAudio signal.

params

ratelinear?..?
modediscrete0..1(default 1)
startlinear?..?
endlinear?..?
polydiscrete0..1(default 0)
source · samsloop.ts
shapedramps sources

SHAPEDRAMPS is a sync-locked parametric ramp generator for video coordinate synthesis — it draws gradients across the raster rather than processing an incoming picture. It emits four mono-video ramps: h_lin/v_lin are stable identity ramps (red channel = screen u or v, untouched by any knob or CV) for clean raster passthrough into geometry modules like RUTTETRA; h_out/v_out are shaped ramps that morph through four canonical shapes via H Shape / V Shape (0..1): linear (t), triangle (abs(2t-1)), soft-fold (0.5 - 0.5*cos(2pi*t)), and radial (H = distance from center scaled so corners read 1, V = angle around center), blending linearly between adjacent shapes. H/V Phase shift the ramp before shaping; H/V Freq scale the axis variable and fract-wrap it, so freq=2 repeats the shape twice across the canvas (a triangle becomes a two-peak zigzag). It also packs two general-purpose 2-channel video crossfade mixers (out = (1-amount)*A + amount*B) so you can blend ramp shapes without an external V-MIXER, though they accept any mono-video signal. Typical use: feed h_lin/v_lin into a coordinate consumer for an identity raster, then crossfade toward h_out/v_out to warp the geometry; all four ramps and both mixers render every frame so downstream consumers always read fresh textures.

shapedrampsh_shapecvv_shapecvh_phasecvv_phasecvh_freqcvv_freqcvmix1_amono-videomix1_bmono-videomix2_amono-videomix2_bmono-videomix1_cvcvmix2_cvcvh_linmono-videov_linmono-videoh_outmono-videov_outmono-videomix1_outmono-videomix2_outmono-videoaudiocvgatepitch

inputs

h_shapecvCV -> h_shape param.
v_shapecvCV -> v_shape param.
h_phasecvCV -> h_phase param.
v_phasecvCV -> v_phase param.
h_freqcvCV -> h_freq param.
v_freqcvCV -> v_freq param.
mix1_amono-videomono-video
mix1_bmono-videomono-video
mix2_amono-videomono-video
mix2_bmono-videomono-video
mix1_cvcvCV -> mix1 param.
mix2_cvcvCV -> mix2 param.

outputs

h_linmono-videomono-video
v_linmono-videomono-video
h_outmono-videomono-video
v_outmono-videomono-video
mix1_outmono-videomono-video
mix2_outmono-videomono-video

params

h_shapelinear0..1
v_shapelinear0..1
h_phaselinear0..1
v_phaselinear0..1
h_freqlinear0.5..8
v_freqlinear0.5..8
mix1linear0..1
mix2linear0..1
source · shapedramps.ts
shapes sources

SHAPES is a procedural geometry source: it has no video input and synthesizes a mono-video stream entirely in its fragment shader. Each frame the shader evaluates a signed-distance field for one of three primitives — a circle, a square, or an equilateral triangle pointing up — and renders it white-on-black, antialiased with a soft edge band. The shape is picked discretely (the Shape value is rounded to the nearest integer; there is no morph or blend between primitives). The frame's UV coordinates are rotated and divided by the zoom factor before the SDF is evaluated, so larger zoom grows the shape's footprint while rotation spins it about its cell center; the antialiasing band is scaled by 1/zoom so the outline stays crisp even when the shape fills the frame. With Tile off the whole frame is a single cell holding one centered shape; with Tile on the frame is repeated (via fract of the UVs) into a Grid×Grid array of identical cells, each carrying its own centered copy. Use it as a clean mask/matte or pattern generator feeding compositors, displacement, or feedback stages; patch CV into shape/tile/rotate/zoom to animate the geometry from the audio side.

shapesshapecvtilecvrotatecvzoomcvoutmono-videoaudiocvgatepitch

inputs

shapecvCV -> shape param.
tilecvCV -> tile param.
rotatecvCV -> rotate param.
zoomcvCV -> zoom param.

outputs

outmono-videomono-video

params

shapediscrete0..2
tilediscrete0..1
tileNlinear1..16
rotatelinear-3.14159..3.14159
zoomlog0.05..10
source · shapes.ts
six strum sources

SIX STRUM — a 6-string guitar/bass/harp INSTRUMENT: six of our KARPLUS extended-Karplus-Strong string voices side by side, each behind its own amplitude ADSR, summed to MONO through a tuning-matched resonant BODY. Three ways to play it, all into one engine: STRUM by hand via six edge-trigger inputs NORMALLED low→high (patch only strum #1 to barre all six with one gate; patch #1 and #4 for two independent strum groups; STRUM SPREAD + DIR set the roll speed and down/up/alternate direction); play polyphonically from the POLY input (the 16-lane polyPitchGate cable — lanes 1–6 → strings 1–6, note-on plucks, note-off releases); or feed one root to the mono CHORD pitch-CV input and it voices a real guitar chord across the strings (each string takes the lowest chord-tone at/above its open pitch; the CHORD selector picks maj/min/dom7/maj7/min7/sus4/power5/octaves). Six MUTE gates model a finger laid loosely on a string — while high that string goes dead and near-unpitched (a palm-mute thunk; MUTE depth sets how dead), gate all six to choke the chord. GUITAR/BASS/HARP are NOT hidden presets: they are knob states of this ONE engine — TUNING (open-string set: guitar EADGBE / a low six-string bass / a diatonic harp), REGISTER (octave), RING (string sustain, calibrated to real plucked-string decay research — ~2.5 s guitar, long dark bass, very long harp), MATERIAL (nylon↔steel), PICK POS/TONE/GRAIN (where + how hard it is plucked), STIFF (inharmonicity toward wound/metal), plus SPREAD (per-string detune + always-distinct excitation seeds so a barre chord choruses instead of phase-combing) and BODY (the box resonance). Per-string ADSR: fast ATTACK, SUSTAIN held at 1 so the string's own physical ring IS the sustain, RELEASE bites on note-off / mute. ACCENT is a shared per-hit velocity CV (louder + brighter), plus a per-knob CV input on the voice + strum controls (tone_cv/grain_cv/spread_cv/body_cv sweep PICK TONE/GRAIN, SPREAD, BODY full-range around the knob; strum_cv sweeps the STRUM roll; the DISCRETE dir_cv/chord_cv quantize a −1..+1 CV across the DIR 0..2 and CHORD 0..7 selector indices). Mono out; no per-voice controls beyond the shared panel. Card: a STRUM audition button barres all six strings; the rear PatchPanel groups the inputs per string (strum + mute) plus POLY / CHORD / ACCENT and the PICK · STRUM CV modulators.

six strumpolypolyPitchGatechordpitchstrum1gatestrum2gatestrum3gatestrum4gatestrum5gatestrum6gatemute1gatemute2gatemute3gatemute4gatemute5gatemute6gateaccentcvtone_cvcvgrain_cvcvspread_cvcvbody_cvcvstrum_cvcvdir_cvcvchord_cvcvoutaudioaudiocvgatepitch

inputs

polypolyPitchGatepolyPitchGate
chordpitchV/oct pitch CV.
strum1gateGate signal (rising/falling edge).
strum2gateGate signal (rising/falling edge).
strum3gateGate signal (rising/falling edge).
strum4gateGate signal (rising/falling edge).
strum5gateGate signal (rising/falling edge).
strum6gateGate signal (rising/falling edge).
mute1gateGate signal (rising/falling edge).
mute2gateGate signal (rising/falling edge).
mute3gateGate signal (rising/falling edge).
mute4gateGate signal (rising/falling edge).
mute5gateGate signal (rising/falling edge).
mute6gateGate signal (rising/falling edge).
accentcvControl voltage.
tone_cvcvCV -> pickTone param.
grain_cvcvCV -> pickGrain param.
spread_cvcvCV -> spread param.
body_cvcvCV -> body param.
strum_cvcvCV -> strumSpread param.
dir_cvcvCV -> strumDir param.
chord_cvcvCV -> quality param.

outputs

outaudioAudio signal.

params

registerst-24..24(default 0)
rings0.1..10(default 2.5)
materiallinear0..1(default 0.55)
pickPoslinear0.02..0.5(default 0.17)
stiffnesslinear0..1(default 0.06)
pickTonelinear0..1(default 0.6)
pickGrainlog0.1..4(default 1)
attacks0.0005..5(default 0.003)
envDecays0.001..5(default 0.12)
sustainlinear0..1(default 1)
releases0.001..5(default 0.35)
muteDepthlinear0..1(default 0.5)
strumSpreadlinear0..1(default 0.28)
strumDirdiscrete0..2(default 0)
spreadlinear0..1(default 0.25)
bodylinear0..1(default 0.35)
leveldB-24..12(default 0)
tuningdiscrete0..2(default 0)
qualitydiscrete0..7(default 0)
source · sixstrum.ts
snare drum sources

Deep, flexible stereo SNARE VOICE with a polyphonic two-hand DRUMROLL — the mate to KICK DRUM (own-code). Four decoupled acoustic layers the way a real snare works: a HEAD modal bank at inharmonic Bessel-zero ratios (1.0/1.03/1.593/2.135 — the pitchless membrane "thunk", self-ringing Chamberlin resonators struck by an impulse, with a downward pitch-drop at the strike), band-passed noise BODY around the head (TONE crossfades HEAD↔BODY), the SNARE-WIRE buzz — the defining sizzle — as bright HP-tunable noise on a SHARED re-excitable bed that breathes with the rectified head displacement AND rings out between strokes, and a short CRACK stick-contact transient. TWO strike inputs into one synth: trigger_in fires ONE hit per rising edge; gate_in runs the drumroll WHILE high. The roll is genuinely POLYPHONIC — two alternating hands 180° interleaved, each stroke (and each buzz sub-stroke) allocating its own voice from a 10-voice lowest-energy-steal pool while the shared wire bed sustains continuity, so overlapping decaying tails SUPERPOSE into a continuous roll (NOT a pulsed one-shot retrigger). ROLL SPEED sets 4–24 strokes/hand (+ roll_speed_cv at 1V/oct), BOUNCE morphs single-stroke → double/open → dense multi-bounce buzz/press roll (a coefficient-of-restitution bounce train, ≤6 sub-strokes, more as the hands slow), HUMANIZE adds seeded (deterministic) timing/velocity/detune jitter, and a hard per-second allocation budget routes excess buzz density into bed re-excitation only. The summed pool + bed run ONE shared bus: an oversampled DRIVE with a single HARD character switch (clean-warm tanh @2× vs aggressive wavefold+asym @4×), a 20 Hz DC block, and a per-channel true-peak CEILING soft-clip. Stereo: SPREAD pans the two hands (constant-power) + detunes them, WIDTH decorrelates only the bright wire sizzle; head/body stay centered so width=0 AND spread=0 → L==R exactly (mono-safe fold-down). Inputs: trigger_in (edge-trigger STRIKE), gate_in (edge-gate DRUMROLL), roll_speed_cv, accent_in (per-hit velocity + drive/level macro, latched at each strike), pitch_cv (1V/oct whole-voice transpose), choke_in (level-sensitive hand-on-head mute), PLUS a per-control CV input for each of the 21 remaining voice knobs (tune_cv … level_cv — each ±1 sweeps its param full-range around the live knob, cvScale matched to the knob curve), alongside the existing roll_speed_cv. Level −24..+12 dB, guarded by the ceiling. Wide 3u banded card: HEAD·BODY·WIRE / CRACK·ROLL·DRIVE / STEREO·OUT. Ships as a clean, punchy snare; hold a long gate for a continuous two-hand roll.

snare drumtrigger_ingategate_ingateroll_speed_cvcvaccent_incvpitch_cvcvchoke_ingatetune_cvcvhead_decay_cvcvdamping_cvcvdamp_cvcvpitch_amt_cvcvpitch_time_cvcvtone_cvcvbody_decay_cvcvwire_cvcvwire_tone_cvcvwire_decay_cvcvcrack_cvcvcrack_tone_cvcvbounce_cvcvhumanize_cvcvdrive_cvcvhard_cvcvceiling_cvcvspread_cvcvwidth_cvcvlevel_cvcvaudio_laudioaudio_raudioaudiocvgatepitch

inputs

trigger_ingateGate signal (rising/falling edge).
gate_ingateGate signal (rising/falling edge).
roll_speed_cvcvControl voltage.
accent_incvControl voltage.
pitch_cvcvControl voltage.
choke_ingateGate signal (rising/falling edge).
tune_cvcvCV -> tune param.
head_decay_cvcvCV -> head_decay param.
damping_cvcvCV -> damping param.
damp_cvcvCV -> damp param.
pitch_amt_cvcvCV -> pitch_amt param.
pitch_time_cvcvCV -> pitch_time param.
tone_cvcvCV -> tone param.
body_decay_cvcvCV -> body_decay param.
wire_cvcvCV -> wire param.
wire_tone_cvcvCV -> wire_tone param.
wire_decay_cvcvCV -> wire_decay param.
crack_cvcvCV -> crack param.
crack_tone_cvcvCV -> crack_tone param.
bounce_cvcvCV -> bounce param.
humanize_cvcvCV -> humanize param.
drive_cvcvCV -> drive param.
hard_cvcvCV -> hard param.
ceiling_cvcvCV -> ceiling param.
spread_cvcvCV -> spread param.
width_cvcvCV -> width param.
level_cvcvCV -> level param.

outputs

audio_laudioAudio signal.
audio_raudioAudio signal.

params

tuneHz90..400(default 180)
tonelinear0..1(default 0.5)
dampinglinear0..1(default 0.4)
head_decayms30..600(default 180)
body_decayms20..300(default 110)
pitch_amtst0..12(default 3)
pitch_timems3..80(default 18)
wirelinear0..1(default 0.7)
wire_toneHz1500..9000(default 4500)
wire_decayms40..700(default 260)
cracklinear0..1(default 0.4)
crack_toneHz800..7000(default 3200)
damplinear0..1(default 0.2)
roll_speedlinear0..1(default 0.5)
bouncelinear0..1(default 0.35)
humanizelinear0..1(default 0.2)
spreadlinear0..1(default 0.5)
drivelinear0..1(default 0.2)
harddiscrete0..1(default 0)
ceilinglinear0..1(default 0.5)
widthlinear0..1(default 0.4)
leveldB-24..12(default 0)
source · snaredrum.ts
spirographs sources

SPIROGRAPHS — a classic-spirograph video GENERATOR (a pure synth SOURCE: no video input). It draws 1–3 INDEPENDENT spirograph curves — HYPOTROCHOIDS (the rolling circle rolls INSIDE the fixed one) or EPITROCHOIDS (OUTSIDE) — each with its OWN full parameter set + matching CV, each DRIFTING around the screen with its fixed circle bouncing off the frame edges like a real spirograph pinned to the page. THE CURVES (a pen at offset p in a rolling circle of radius r rolling on/in a fixed circle of radius R): hypotrochoid x=(R−r)cos t + p·cos(((R−r)/r)t), y=(R−r)sin t − p·sin(((R−r)/r)t); epitrochoid x=(R+r)cos t − p·cos(((R+r)/r)t), y=(R+r)sin t − p·sin(((R+r)/r)t). The parameter t sweeps over exactly enough revolutions to CLOSE the figure — derived from the reduced R:r ratio (revolutionsToClose = the denominator of R/r in lowest terms); irrational-ish ratios are CAPPED at a sane maximum so the curve dense-fills the annulus instead of running forever. COUNT (1..3, DISCRETE knob + CV) sets how many spiros render. Each spiro i∈{1,2,3} owns ten params (port/param id sI_<name>), EACH with a knob AND a CV input: fixedRadius (R), rollingRadius (r), penOffset (p), inside (0=epitrochoid/outside, 1=hypotrochoid/inside — a discrete toggle), rotation, scale, xOffset, yOffset, thickness (real px line-width), and chroma (a colorwheel HUE for that spiro). MOTION: each spiro's CENTER drifts on its OWN per-spiro velocity/phase (the three never move in lockstep); the FIXED-radius circle (R scaled to screen) is CONSTRAINED to stay fully inside the frame and rolls/BOUNCES (elastic reflection) off the perimeter when it hits an edge — only the fixed circle's center+R is bound-constrained (closed-form, deterministic), while the drawn CURVE may extend past the viewport and clip (desired). The reflect/bounce + the curve math live in the pure, unit-tested $lib/video/modules/spirographs-math. RENDERING: Canvas2D polylines (real line-width with round joins/caps) painted to an OffscreenCanvas and uploaded as a GL texture each frame (the SHAPEGEN/TEXTMARQUEE path) — the right tool for thick stroked curves, where a GLSL distance-field would be costlier and read worse. OUTPUTS (all video): out (video) — the full-COLOUR composite, each spiro in its chroma hue additively blended on black so crossings glow; mono_out (mono-video) — every spiro stroked WHITE on black, a clean matte for keying / luma effects (reachable via read('outputTexture:mono_out')); overlap (video, labelled CANDY) — a COLOUR-OVERLAP output: the per-pixel overlap DENSITY (how many lines stack there — self-crossings AND multiple spiros) is colour-mapped into a rainbow that CASCADES with the count (deep cool hue for one line, racing through green→yellow→red→magenta as lines pile up) and blooms toward a white candy core where many overlap — gooey "candy" goodness (reachable via read('outputTexture:overlap')). CARD: a live preview of the colour OUT, the COUNT knob, a 1/2/3 SPIRO SELECTOR that swaps the knob bank to that spiro, an INSIDE/OUTSIDE toggle, a CHROMA colorwheel, and the per-spiro fader bank. All ports live on the yellow drill-down PATCH PANEL (no raw side jacks); the drill-down GROUPS the CV inputs per-spiro (a count section + spiro1 / spiro2 / spiro3 sections). USAGE: dial COUNT, pick a spiro tab, tune R/r/pen for the figure (low gcd ratios make few-lobed flowers, coprime ratios dense rosettes), set INSIDE/OUTSIDE + chroma, then patch out → OUTPUT / a video mixer / an effect — or modulate any per-spiro param from an LFO/sequencer for an animated, drifting spirograph.

spirographsoutvideomono_outmono-videooverlapvideoaudiocvgatepitch

outputs

outvideovideo
mono_outmono-videomono-video
overlapvideovideo
source · spirographs.ts
swolevco sources

Buchla 259-style complex waveform generator — the "swole VCO" of the lineup: a primary oscillator and a sine modulator in one module. The primary blends saw → triangle → square via the SYMMETRY control, then passes through a West-Coast wavefolder (FOLD). TIMBRE is audio-rate cross-modulation: the modulator FMs the primary (up to ~±4 semitones of deviation) for the classic Buchla harmonic complexity. Pitch is 1 V/oct (0 V = C4) with tune/fine knobs. Outputs the folded primary, the raw modulator, and a summed mix, plus a mono-video SCOPE output of the primary waveform for cross-domain video patching. Pure Web Audio, modeled after ILLOGIC's structure.

swolevcopitchpitchmod_pitchpitchfmaudiotimbrecvsymmetrycvfoldcvratiocvoutaudiomod_outaudiosum_outaudioscopemono-videoaudiocvgatepitch

inputs

pitchpitchV/oct pitch CV.
mod_pitchpitchV/oct pitch CV.
fmaudioAudio signal.
timbrecvCV -> timbre param.
symmetrycvCV -> symmetry param.
foldcvCV -> fold param.
ratiocvCV -> ratio param.

outputs

outaudioAudio signal.
mod_outaudioAudio signal.
sum_outaudioAudio signal.
scopemono-videomono-video

params

tunest-36..36(default 0)
fine¢-100..100(default 0)
mod_tunest-36..36(default 0)
mod_fine¢-100..100(default 0)
ratiolinear0..8(default 1)
timbrelinear0..1(default 0)
symmetrylinear0..1(default 0.5)
foldlinear0..1(default 0)
source · swolevco.ts
textmarquee sources

TEXTMARQUEE — a rich-text MARQUEE video GENERATOR (source). MODEL: you type a styled paragraph in the card's tiny rich-text editor (a contenteditable region + a small toolbar); it serializes into a small RICH-TEXT MODEL — an array of paragraphs, each a list of styled RUNS `{ text, bold, italic, underline, color }` + a paragraph `align` (left/center/right), plus a layer FOREGROUND (default glyph colour) + BACKGROUND fill. That model persists in node.data.richText (Y.Doc-synced) and is the single source of truth for BOTH the editor DOM and the video texture. CONTROLS (card): the toolbar = ALIGN left/center/right, BOLD, ITALIC, UNDERLINE, per-character TEXT COLOR (pick a colour for the current selection), and the layer FG + BG colour swatches; below the editor are four knobs (ScrlX/ScrlY/PosX/PosY) and a live preview of the OUT layer. RENDERING: the model is laid out + drawn to an OFFSCREEN 2D canvas with SYSTEM FONTS (real glyphs — system-font text cannot be rasterized in GLSL, so a 2D-canvas→texture upload is the clean path: measure each run in its font/weight/style, draw with per-run colour + underline, honour align + bg fill), uploaded as a WebGL texture, and drawn into the module's FBO at a SCROLL offset + screen POSITION — a 90s-screensaver marquee. A freshly-spawned node renders a "textmarquee" placeholder until you type. I/O: OUT (video) — the rendered scrolling text layer. CV (each port id == param id, linear cvScale so a bipolar ±1 source sweeps the param's full range centred on the knob): ScrlX / ScrlY — horizontal / vertical scroll SPEED (BIPOLAR knob; 0.5 = static, <0.5 scrolls one way, >0.5 the other; the text wraps + re-enters from the opposite edge — a continuous ribbon). PosX / PosY — raw screen POSITION 0..1, CALIBRATED so 0 = text fully off one edge, 1 = fully off the other, 0.5 = centred (drawX = -textWidth + posX*(screenW+textWidth)); with the default-centred knob a bipolar LFO patched into PosX/PosY sweeps the text ALL THE WAY across — fully off the left, through centred, to fully off the right, and back. USAGE: type + style your banner, set FG/BG, then either crawl it with ScrlX/ScrlY (a scrolling marquee) or sweep PosX/PosY from an LFO/sequencer for a CV-driven swoosh; patch OUT into OUTPUT, a video mixer, or any video effect to title/overlay another layer. All ports live on the yellow drill-down PATCH PANEL (no raw side jacks). The pos/scroll/wrap math + the rich-text layout/measurement are pure, unit-tested helpers in $lib/video/modules/textmarquee-layout.

textmarqueescrollXcvscrollYcvposXcvposYcvoutvideoaudiocvgatepitch

inputs

scrollXcvCV -> scrollX param.
scrollYcvCV -> scrollY param.
posXcvCV -> posX param.
posYcvCV -> posY param.

outputs

outvideovideo

params

scrollXlinear0..1
scrollYlinear0..1
posXlinear0..1
posYlinear0..1
source · textmarquee.ts
tidy vco sources

TIDY VCO — flagship virtual-analog SUBTRACTIVE SYNTH VOICE: two polyBLEP oscillators with a continuous saw↔pulse SHAPE morph per osc, shared PW + audio-rate PWM CV, OSC2 octave switch + cents detune, and a −1-octave sub square, into an ALL-NEW nonlinear zero-delay-feedback DIODE LADDER filter (EMS VCS3 / TB-303 lineage — bidirectionally-coupled stages, soft warm knee into 24 dB/oct, feedback squelch limiter for a bounded near-sine self-oscillation, CUTOFF calibrated to the resonant pitch within 3 cents so keytracked self-osc plays in tune, DRIVE tanh saturation at 2× oversampling, part-compensated squelch bass dip). Two RC-curve "punch" ADSRs (CEM3310-style exponential segments, overshoot-target convex attack, analog resume-from-level retrigger): a filter EG with bipolar ±4-octave ENV amount + keytracking, and an amp EG into an OTA-flavored soft-knee VCA whose tanh bias blooms gentle even harmonics with level. 5-voice POLY on the polyPitchGate chord bus (lane i → voice i, release tails hold their pitch) AND a mono pitch/gate pair driving a REAL 2-voice unison (±7¢·WIDTH drift panned to opposite sides — true stereo beating); WIDTH also fans the poly voices across the stereo field (root anchored center). Stereo out_l/out_r pair (auto-wires R when L is patched), HOLD pad for droning the voice from the card, and a CV jack for EVERY control (27 inputs): the six original CVs — cutoff (4 oct/V, audio-rate), res, pwm (audio-rate), drive, fold (audio-rate), sym (audio-rate) — PLUS a GLOBAL block-rate per-knob CV for each remaining control: shape1/shape2/mix/sub/fsus/sus/track/width (0..1 full-swing), detune (±50¢), oct2 (discrete ±1 step/V), env (±4-oct bipolar), the six EG times (4 oct/V), and level (±18 dB/V). Every law is scaled in the shared core (lib/tidy-vco-dsp.ts) so cv = 0 is a byte-exact no-op. The rear patch panel groups its jacks into OSC·WAVEFOLD·DIODE FILTER·FILTER EG·AMP EG·OUT·POLY/OUT sections mirroring the card headers.

tidy vcopolypolyPitchGatepitchcvgategatecutoff_cvcvres_cvcvpwm_cvcvdrive_cvcvfold_cvcvsym_cvcvshape1_cvcvshape2_cvcvdetune_cvcvoct2_cvcvmix_cvcvsub_cvcvenv_cvcvtrack_cvcvfatk_cvcvfdec_cvcvfsus_cvcvfrel_cvcvatk_cvcvdec_cvcvsus_cvcvrel_cvcvwidth_cvcvlevel_cvcvout_laudioout_raudioaudiocvgatepitch

inputs

polypolyPitchGatepolyPitchGate
pitchcvControl voltage.
gategateGate signal (rising/falling edge).
cutoff_cvcvControl voltage.
res_cvcvControl voltage.
pwm_cvcvControl voltage.
drive_cvcvControl voltage.
fold_cvcvControl voltage.
sym_cvcvControl voltage.
shape1_cvcvControl voltage.
shape2_cvcvControl voltage.
detune_cvcvControl voltage.
oct2_cvcvControl voltage.
mix_cvcvControl voltage.
sub_cvcvControl voltage.
env_cvcvControl voltage.
track_cvcvControl voltage.
fatk_cvcvControl voltage.
fdec_cvcvControl voltage.
fsus_cvcvControl voltage.
frel_cvcvControl voltage.
atk_cvcvControl voltage.
dec_cvcvControl voltage.
sus_cvcvControl voltage.
rel_cvcvControl voltage.
width_cvcvControl voltage.
level_cvcvControl voltage.

outputs

out_laudioAudio signal.
out_raudioAudio signal.

params

shape1linear0..1(default 0)
shape2linear0..1(default 0)
pwlinear0.05..0.5(default 0.5)
detune¢-50..50(default 6)
oct2discrete-1..1(default 0)
mixlinear0..1(default 0.5)
sublinear0..1(default 0.15)
foldlinear0..1(default 0)
symlinear-1..1(default 0)
cutoffHz40..14000(default 900)
reslinear0..1(default 0.35)
drivelinear0..1(default 0.25)
envlinear-1..1(default 0.45)
tracklinear0..1(default 0.4)
fatks0.0005..5(default 0.005)
fdecs0.001..5(default 0.35)
fsuslinear0..1(default 0.2)
frels0.001..5(default 0.3)
atks0.0005..5(default 0.003)
decs0.001..5(default 0.25)
suslinear0..1(default 0.75)
rels0.001..5(default 0.25)
widthlinear0..1(default 0.4)
leveldB-24..12(default 0)
holddiscrete0..1(default 0)
source · tidy-vco.ts
tom drum sources

Analog-modeled TOM DRUM voice — the third member of the drum family (KICK DRUM / SNARE DRUM), at deliberately CURATED complexity: one synthesis engine, seven voice knobs + level, spanning the classic analog tom lineage in one continuous space (808-woody bridged-T ring, 909-punchy swept osc + overtone, Simmons SDS-V "piuuu" dive-bomb, deep floor tom). DSP (own-code, packages/dsp/src/lib/tomtom-dsp.ts): a MEMBRANE fundamental (Tune 60–400 Hz) plus the inharmonic 1.593× Bessel second mode (TONE tilts fundamental ↔ overtone, with its own faster decay) riding ONE exponential pitch-BEND envelope (Bend 0–24 st depth — 0 = stable pitch, 24 = a two-octave zap; B Time 10–300 ms), a band-passed BREATH noise layer tracking ~2.5× the settled pitch (NOISE balances membrane ↔ breath, the SDS-V tone/noise mix law — 808 breath at low settings, full Simmons noise hit at the top), a 2×-oversampled warm-tanh DRIVE, 20 Hz DC block, dB LEVEL, and a true-peak tanh bound (|out| < 1 always). DECAY (40–1500 ms) is FREQUENCY-COMPENSATED: the −60 dB ring time is set in ms regardless of Tune, so a 60 Hz floor tom and a 400 Hz timbale ring equally long at the same knob. Inputs: trigger_in (edge-trigger STRIKE — phases reset, envelopes fire), accent_in (per-hit 0..1 CV latched at the strike edge: up to +80 % velocity AND +50 % bend depth, like a harder stick), pitch_cv (1V/oct whole-voice transpose incl. the breath band), bend_cv (±24 st/V into Bend — full-swing), decay_cv (2 oct of decay TIME per volt), tone_cv / noise_cv (sum into the balances). A per-knob CV now covers EVERY continuous control: tune_cv (2 oct/V on the TUNE knob — distinct from the whole-voice pitch_cv), bend_time_cv (2 oct of sweep-settle time/V), drive_cv (sums into DRIVE), and level_cv (±18 dB/V — the full 36 dB range centered on the knob). Each law is scaled in the shared core so cv = 0 is a perfect no-op. Output: ONE mono audio_out. Card: compact MEMBRANE·COLOR·OUT fader band + a press-to-fire STRIKE pad (the `strike` param, OR-ed with trigger_in in the worklet — one hit per press edge); the rear patch panel groups its jacks into MEMBRANE·COLOR·OUT·TRIG/OUT sections mirroring the card headers. Control set modeled on the Vermona DRM1 tom channel (tune / bend / decay / noise / drive).

tom drumtrigger_ingateaccent_incvpitch_cvcvbend_cvcvdecay_cvcvtone_cvcvnoise_cvcvtune_cvcvbend_time_cvcvdrive_cvcvlevel_cvcvaudio_outaudioaudiocvgatepitch

inputs

trigger_ingateGate signal (rising/falling edge).
accent_incvControl voltage.
pitch_cvcvControl voltage.
bend_cvcvControl voltage.
decay_cvcvControl voltage.
tone_cvcvControl voltage.
noise_cvcvControl voltage.
tune_cvcvControl voltage.
bend_time_cvcvControl voltage.
drive_cvcvControl voltage.
level_cvcvControl voltage.

outputs

audio_outaudioAudio signal.

params

tuneHz60..400(default 110)
bend_amtst0..24(default 7)
bend_timems10..300(default 60)
decayms40..1500(default 350)
tonelinear0..1(default 0.35)
noiselinear0..1(default 0.25)
drivelinear0..1(default 0.25)
leveldB-24..12(default 0)
strikediscrete0..1(default 0)
source · tomtom.ts
toybox sources

Multi-layer video compositor. FOUR layers, each rendered into its own framebuffer then reduced to the output by a combine DAG (fade / lumakey / chromakey / map). A layer kind selects its source: GEN = a generative fragment-shader content entry from the bundled bank (noise-fbm domain-warped simplex FBM, worley-cells animated cellular noise; the FX hsv-plasma / cos-gradient palette shaders; the SHADERTOY synthwave-sunset port) with iTime + iResolution + its declared float params on faders — NO scene input. FRAG = a Shadertoy fragment shader that RECEIVES the composited layer below as iChannel0 (recolour / displace / feedback FX, e.g. frag-invert-scan). TOYBOX hosts a faithful SHADERTOY RUNTIME: a `void mainImage(out vec4, in vec2)` source is wrapped through a mainImage→main shim with the FULL Shadertoy uniform set (iTime, iResolution as vec3, iTimeDelta, iFrame, iFrameRate, iMouse vec4 with .z/.w press semantics, iDate, iChannel0-3 + iChannelResolution[4]); the preview canvas routes pointer events to iMouse (client→engine px, GL bottom-origin Y-flip). A GEN/FRAG layer can host a MULTI-BUFFER Shadertoy project (a Common chunk + N buffer passes + an Image pass) — each pass owns its own FBO (RGBA32F via createFloatFbo for intBitsToFloat-packed / signed-precision buffers, degrading to RGBA8), channels resolve to another buffer pass output / its own previous frame (ping-pong feedback) / a keyboard stub / the scene / none, topo-ordered producers-first with Image last; the bundled GROWING PEAK preset is an ORIGINAL multi-buffer project (a growable self-feedback heightmap buffer → a raymarched weather sky Image pass) where CLICKING the preview grows the mountain via iMouse. OBJ = a 3D mesh layer (Phase 3): a bundled CC0 OBJ (Spot the cow, Utah teapot, chess pawn — parsed by an in-house ASCII OBJ parser with auto-center/auto-scale + computed flat normals) OR a built-in procedural primitive (cube / sphere / torus / hypercube tesseract; no asset file), matcap-shaded with depth testing — the matcap is synthesized procedurally in-shader (chrome / clay / neon styles, zero asset-license surface) and the layer carries rotX/rotY/rotZ, scale, spin (auto-rotate) and an RGB tint. An OBJ layer can optionally UV-map ANOTHER layer's rendered output (material.surfaceSource = that layer index, surfaceMix the blend) onto the mesh as a SURFACE TEXTURE in place of (blended with) the matcap — a per-frame dependency-ordered render pass guarantees the source layer renders first, and a self / cyclic / out-of-range source degrades to matcap-only (no WebGL feedback loop). OBJs with no authored texture coords get a planar XY-projected UV so the surface texture isn't collapsed to a single texel. The content/model catalogs + per-shader param schema live in a static manifest (packages/web/static/toybox/manifest.json), enumerated through the dynamic asset-provider seam (bundled + session-registered runtime assets); GLSL + OBJs are fetched lazily on selection (never JS-bundled) and cached. IMAGE = a synced still picture (bytes ride the Y.Doc); VIDEO = a local-file / webcam / patched-feed (inA-inB) / layer-input-tap texture, rounding out the seven layer kinds. RANDOMIZE: the RANDOM button (preset row) rolls a complete curated random patch from a seeded pure engine — it picks among hand-designed structural ARCHETYPE families (weighted, with anti-repeat across consecutive presses), draws content through the asset-provider seam, rolls scalars from designer-tuned ranges (never uniform noise), and INCORPORATES whatever is patched in: a feed on inA/inB becomes a live, load-bearing video layer in every roll and every patched cv1..cv6 port gets a route to a param that exists in the result; rack cables are never created, moved or severed. Rolls RESTRUCTURE the combine graph itself (branch-and-merge diamonds, mid-chain transforms, feedback taps — not just new content in a fixed ladder). LOCKS: a padlock toggle on each layer tab and a Lock item in each op node's right-click menu mark elements IMMUNE from randomize — a locked layer is byte-identical across rolls at its index, a locked node survives with its params, position and upstream feeds (which implicitly locks the source layers it consumes), and existing cv routes onto locked targets are preserved; lock flags ride the locked objects in node.data (synced, saved, exported). Each roll applies atomically in ONE Yjs transaction (one Cmd-Z undoes one roll) and a REVERT button restores the patch as it stood before the session's first roll — honoring locks exactly like a roll does (locked parts keep their current state). Persistence: node.data.layers (4-length array of { kind, contentId, params, material }) + node.data.combine. One video output (out).

toyboxinAvideoinBvideooutvideoaudiocvgatepitch

inputs

inAvideovideo
inBvideovideo

outputs

outvideovideo
source · toybox.ts
tree.oh.vox sources

TB-303 voice slice — clean-room TypeScript port of the voice subset of Robin Schmidt's Open303 (MIT, https://github.com/RobinSchmidt/Open303). 6 canonical 303 knobs (TUNE ±12 st, CUTOFF 40 Hz – 6 kHz, RESONANCE 0..1, ENVELOPE 0..1, DECAY 50 ms – 3 s, ACCENT 0..1) plus pitch / gate / accent_in audio-rate inputs and per-knob CV. The DSP is the TB_303 mode of rosic::TeeBeeFilter (the diode-feedback ladder with feedback HP — NOT a moogafakkin ladder; that is the whole point of Open303), the rosic::DecayEnvelope on cutoff, a simplified AR amp envelope mirroring rosic::AnalogEnvelope, and a polyBLEP saw replacing the BlendOscillator wavetable (the 303 character lives in the filter, not the oscillator). Cutoff is modulated per-sample via Open303's measured-mapping scaler+offset formula. All 6 knobs have an 80 Hz one-pole WtParamSmoother on the audio thread (per PR #435) so knob drags and CV ride pop-free through the steep filter. Accent boosts both amp peak and filter env contribution on accented notes. The full 404 module — sequencer + transpose + slide + waveform switch + TD-3 smiley — is queued as a follow-up.

tree.oh.voxpitch_inpitchgate_ingateaccent_ingatetune_cvcvcutoff_cvcvres_cvcvenv_cvcvdecay_cvcvaccent_cvcvwaveform_cvcvaudio_outaudioaudiocvgatepitch

inputs

pitch_inpitchV/oct pitch CV.
gate_ingateGate signal (rising/falling edge).
accent_ingateGate signal (rising/falling edge).
tune_cvcvCV -> tune param.
cutoff_cvcvCV -> cutoff param.
res_cvcvCV -> resonance param.
env_cvcvCV -> envelope param.
decay_cvcvCV -> decay param.
accent_cvcvCV -> accent param.
waveform_cvcvCV -> waveform param.

outputs

audio_outaudioAudio signal.

params

tunest-12..12(default 0)
cutoffHz40..6000(default 1000)
resonancelinear0..1(default 0.5)
envelopelinear0..1(default 0.5)
decayms50..3000(default 600)
accentlinear0..1(default 0.5)
waveformlinear0..1(default 0)
source · treeohvox.ts
tv librarian sources

International live-TV source. Pick a country on the 2D world map (or the country list) → a channel list (filtered to playable HLS streams) → tune a channel and its live picture streams in as an UNTAINTED video texture (validated under the app's COEP require-corp headers: famelack HLS plays + yields a clean WebGL2 texture, so VIDEO out is a real downstream-usable texture, not play-only) plus stereo audio_l/audio_r from the stream's audio track. The "random" button (and the random/next CV trigger inputs) jump channels for happy-accident channel-surfing. Gate outputs: channel_changed pulses on each tune (trigger), stream_online holds high while the stream actually plays (gate). Dead/geo-blocked/unlicensed-pulled streams fail cleanly → marked "unavailable" + auto-skipped, never a hang or a tainted texture. Channel selection persists on the node + syncs to rack-mates (everyone tunes to the same stream). LEGAL: streams are THIRD-PARTY public streams, NOT hosted by patchtogether — this is a player pointed at the same iptv-org-derived directory many "free live TV" sites use; an in-card disclaimer + attribution (Famelack, MIT-licensed dataset fetched at runtime; iptv-org) ship with it, geo-blocked entries are honored/marked, and dead links are filtered.

tv librariannextgaterandomgatevideovideoaudio_laudioaudio_raudiochannel_changedgatestream_onlinegateaudiocvgatepitch

inputs

nextgateGate signal (rising/falling edge).
randomgateGate signal (rising/falling edge).

outputs

videovideovideo
audio_laudioAudio signal.
audio_raudioAudio signal.
channel_changedgateGate signal (rising/falling edge).
stream_onlinegateGate signal (rising/falling edge).

params

gainlinear0..2
cv_nextlinear0..1(default 0)
cv_randomlinear0..1(default 0)
source · tv-librarian.ts
vfpga-runner sources

A HOST module that runs a loaded `.vfpga` declarative effect spec — a "virtual FPGA bitstream" swapped into one reconfigurable card (inspired by, not a clone of, classic video-synth hardware). The module declares the full I/O SUPERSET it can wire — 4 video inputs (vin1..vin4), 4 CV inputs (cv1..cv4), 4 gate inputs (g1..g4), 2 video outputs (vout1 canonical / vout2 via read('outputTexture:vout2')), and an 8-slot generic param bank (p1..p8) — and a loaded VfpgaSpec (node.data.vfpga, picked from the "load preset…" menu) selects which subset is ACTIVE and what GL render-graph runs. The card is manifest-driven: it renders the full port superset as handles (inactive ones dimmed) and shows only the loaded spec's active CV inputs (each with a bipolar SCALE attenuverter + OFFSET + always-on scope), gate inputs (with an activity LED), and its mapped param knobs (p1..pN, labelled + ranged by the spec, MIDI-learnable). CV inputs are linear-scaled into named role uniforms; gate inputs raw-pass into synthetic gN_evt params that the factory hysteresis edge-detects (DOOM/backdraft convention) so a spec's shader can read a held level / rising-edge count. Specs are IN-REPO bundled TypeScript (no user-uploaded code in v1) collected by import.meta.glob; the render runs on the MAIN thread (#1811 — the render worker has no cross-thread input textures for vin1..vin4, its return protocol carries one picture per node so vout2 could not be served, and the card polls read('gateState') every frame). Preset change hot-swaps the GL pipeline. This foundation ships ONE VFPGA: smpte-bars, a pure SMPTE-style colour-bar generator (0 video in → 1 video out, one CV SHIFT role + BRIGHT/SAT params) — a deterministic always-on reference source for bringing up downstream effects.

vfpga-runnervout1videovout2videoaudiocvgatepitch

outputs

vout1videovideo
vout2videovideo
source · vfpga-runner.ts
videobox sources

videobox is a local-file VIDEO PLAYER: you drop (or pick) a video file from disk and it decodes the file each frame into the module's video output, while the file's stereo audio track is split out to the audio_l / audio_r jacks for patching back into the audio domain. The card owns the actual HTMLVideoElement and object-URL; the engine samples that element through a decode-rate frame uploader (only re-uploading when a genuinely new frame lands, downscaled to the engine resolution) so playback stays smooth even at 1080p. Behind the file picker the card uses File System Access handles (Chromium) to remember your pick and one-click-reload it next session; other browsers and other peers fall back to a "Re-link: drop <name>" prompt. The playhead is multiplayer-synced: play, pause and seek write a shared (isPlaying / lastSyncTime / lastSyncPosition) triple to the node so every peer's local copy follows, drift-correcting whenever it slips more than ~0.5s off the expected position. The card is drag-resizable from the bottom-right corner (whole-rack-unit tiles, default and minimum 360x360) so several videoboxes can be tiled into a wall of TVs; size persists on the node and syncs to peers, and the 16:9 video preview grows to fill the resized card. Right-click the preview for Fullscreen (a LOCAL per-peer state, NOT multiplayer-synced) or Full Frame (in-app, the video consumes the whole card, hiding the title/picker/transport/seekbar; double-click to exit), where ONLY Full Frame is synced to peers. Usage: drop a clip, hit Play, and patch video into a mixer/output and audio_l/audio_r into your audio chain; pulse the TRIG input from a clock or button to toggle play/pause hands-free. Idle (no file) shows a faint blue gradient so an empty card reads as alive-but-empty.

videoboxplay_triggergatevideovideoaudio_laudioaudio_raudioaudiocvgatepitch

inputs

play_triggergateGate signal (rising/falling edge).

outputs

videovideovideo
audio_laudioAudio signal.
audio_raudioAudio signal.

params

gainlinear0..2
cv_play_triggerlinear0..1(default 0)
source · videobox.ts
videocube sources

VIDEOCUBE — the VIDEO version of the audio CUBE oscillator. It ingests THREE 60-frame video rings — A (FLOOR), B (WALL/connector), C (CEILING) — each generated LIVE from a connected video input or loaded from a .frametable.png atlas, and combines them exactly the way audio CUBE combines its three wavetables: an OCCUPANCY-WEIGHTED trilinear morph. For every output pixel it reads a colour from each ring, derives an occupancy position from the WALL luma, and blends the three by the SAME cube-dsp occ weights — MORPH cross-fades A↔C through B, CONNECT (+ CONNECT STRENGTH) reshapes/​swells the interior binding, CRUSH posterizes colour depth, SPACE CRUSH mosaics the sampling grid, SPACE DIFFUSE smears the coords, MATERIAL switches soft-blend↔hard mosaic and WRAP mirror-folds — so video_out is a recognizable MORPHED IMAGE of the sources. It ALSO emits AUDIO: the same three rings are reduced to luma heightfields and scanned by the IDENTICAL cube-dsp surface-height slice the audio CUBE plays, so audio_out is a mono wavetable-oscillator drone whose timbre is driven by the SAME knobs (MORPH/CONNECT/CRUSH/SPACE/slice Y·ROT/WRAP/MATERIAL) — the picture and the sound move through one shared field structure. TUNE/FINE set pitch, LEVEL the gain, FOLD a west-coast wavefolder on the audio (audio-only). A global READER (SMOOTH/MORPH/CHAOS) reads each ring's 60-frame history, FREEZE holds the live rings and LIVE forces the real-time read. Beyond video_out + audio_out it exposes SIX dedicated slice-visualizer video jacks — SCOPE (the 256-sample surface-height wave the audio plays), SLICE (the 2-D cutting-plane cross-section), DEPTH (the intersection-depth heightmap, bright=deep/loud), and a SMOOTH/MORPH/CHAOS triptych (the cross-section forced through each reader treatment) — each a different readout of the SAME field/slice, each PER-PORT gated so an unpatched jack costs ZERO GPU, and the SLICE VIEW toggle (TEXTURED/XRAY/WEIGHTS) recolours slice+triptych. Rendered at half engine resolution with a renderer-gated tap count (the FrameTable budget ×3); the audio slice is GPU-reduced + recomputed off the audio thread on a throttle. v1 ships MONO-DRONE-first (poly/ADSR = follow-up). The occupancy combine + colour blend + luma reduction are a 1:1 CPU mirror unit-tested in $lib/video/videocube-core, reusing the audio-CUBE field math (cube-dsp) wholesale. All ports live on the yellow drill-down PATCH PANEL. Look-affecting new WebGL shader — held for owner visual preview.

videocubevideo_avideovideo_bvideovideo_cvideomorph_cvcvconnect_cvcvconnect_strength_cvcvcrush_cvcvspace_crush_cvcvspace_diffuse_cvcvslice_y_cvcvslice_rx_cvcvslice_ry_cvcvslice_rz_cvcvview_x_cvcvview_y_cvcvfold_cvcvspread_cvcvscan_cvcvtune_cvcvchroma_depth_cvcvmotion_cvcvhue_mode_cvcvvideo_outvideoaudio_outaudioscope_outvideoslice_outvideodepth_outvideosmooth_outvideomorph_outvideochaos_outvideoaudiocvgatepitch

inputs

video_avideovideo
video_bvideovideo
video_cvideovideo
morph_cvcvCV -> morph_fc param.
connect_cvcvCV -> connect param.
connect_strength_cvcvCV -> connect_strength param.
crush_cvcvCV -> crush param.
space_crush_cvcvCV -> space_crush param.
space_diffuse_cvcvCV -> space_diffuse param.
slice_y_cvcvCV -> slice_y param.
slice_rx_cvcvCV -> slice_rx param.
slice_ry_cvcvCV -> slice_ry param.
slice_rz_cvcvCV -> slice_rz param.
view_x_cvcvCV -> view_rot_x param.
view_y_cvcvCV -> view_rot_y param.
fold_cvcvCV -> fold param.
spread_cvcvCV -> spread param.
scan_cvcvCV -> scan param.
tune_cvcvCV -> tune param.
chroma_depth_cvcvCV -> chroma_depth param.
motion_cvcvCV -> motion param.
hue_mode_cvcvCV -> hue_mode param.

outputs

video_outvideovideo
audio_outaudioAudio signal.
scope_outvideovideo
slice_outvideovideo
depth_outvideovideo
smooth_outvideovideo
morph_outvideovideo
chaos_outvideovideo

params

tunest-36..36
fine¢-100..100
morph_fclinear0..1
connectlinear0..1
connect_strengthlinear0..1
crushlinear0..1
space_crushlinear0..1
space_diffuselinear0..1
foldlinear0..1
spreadlinear0..1
scanlinear0..1
chroma_depthlinear0..1
motionlinear0..1
slice_ylinear0..1
slice_rxlinear-3.1416..3.1416
slice_rylinear-3.1416..3.1416
slice_rzlinear-3.1416..3.1416
levellinear0..2
view_zoomlinear0.3..3
view_rot_xlinear-3.1416..3.1416
view_rot_ylinear-3.1416..3.1416
view_rot_zlinear-3.1416..3.1416
wrapdiscrete0..1
materialdiscrete0..1
screen_ondiscrete0..1
reader_modediscrete0..2
freezediscrete0..1
livediscrete0..1
slice_viewdiscrete0..2
hue_modediscrete0..1
source · videocube.ts

Local-file VIDEO player with a PERFORMANT varispeed transport AND a 7-SLOT ASSET SELECTOR. SINGLE VIDEO: pick/drop a video (objectUrl + optional FileSystemFileHandle for one-click reload; collaborators re-link their own copy — the bytes stay local, only fileMeta syncs); the frame texture is sampled off requestVideoFrameCallback so the `video` output streams at ANY playback speed (the #291 fix). Transport: SPEED knob (0=-4×…0.5=+1×…1=+4×; reverse scrubs at a throttled ~10 Hz), a START/END window, LOOP vs ONE-SHOT, and rising-edge gates START / PAUSE / RESET / LOOP. Stereo `audio_l` / `audio_r` bridge the file's audio (with a silent keep-alive so an unpatched source keeps decoding at full rate). ASSET SELECTOR: right-click the card → "Load multiple…", a 7-row panel (notes C D E F G A B) that loads up to 7 videos, one per slot; all 7 are PRELOADED as separate <video> elements (first frame decoded) so a switch is instant. Patch a clip player's GATE → ASSET GATE and PITCH → ASSET PITCH: on each ASSET GATE rising edge the module reads ASSET PITCH (raw V/oct), maps it to a slot by PITCH CLASS, and — if that slot holds a loaded video — makes it the active source, RESTARTS IT FROM THE BEGINNING (currentTime=0), plays it (if the transport is playing) under the current speed/window/loop settings, and re-wires its audio to the now-active element. THE 7-NOTE → SLOT TABLE (the default clip's in-key rows, C-major from C3): C3 (MIDI 48) → slot 1, D3 (50) → slot 2, E3 (52) → slot 3, F3 (53) → slot 4, G3 (55) → slot 5, A3 (57) → slot 6, B3 (59) → slot 7. Matching is octave-independent (a C in any octave → slot 1, …); a black-key pitch (C# D# F# G# A#) maps to NO slot → the event is IGNORED (current video keeps playing). MEMORY: 7 preloaded <video> elements are heavy, so each slot's file is capped at 100 MB. The displayed selection is LOCAL render state (computed from the synced gate + per-slot fileMeta), never written to the Y.Doc per gate event. ASSET PITCH / ASSET GATE + the transport gates/CV all live in the card's yellow drill-down PATCH PANEL (no raw side jacks, #767 standard). CROP: a second video output `crop` re-samples a boxed sub-region of the `video` output, scaled up to the full output resolution (a live zoom). Press "add crop" on the card to overlay a resizable, aspect-locked rectangle (thin red border, dimmed outside) on the preview — drag inside to move, drag a corner to resize; the box always keeps the current OUTPUT aspect (16:9 or 4:3) and re-fits when the aspect flips. The rect is stored normalized on the node (x,y,w in 0..1, height derived from the aspect; synced + undoable; ONE per node, unaffected by slot switches). Until a crop is added — or after "remove crop" — the `crop` output passes the full frame through unchanged, so it never goes black and always streams. Reusable crop core ($lib/video/crop-core + crop-render + ui/video/CropOverlay) so other video modules can adopt the same Crop output later.

videovarispeedcv_startgatecv_pausegatecv_resetgatecv_loop_togglegateasset_pitchpitchasset_gategatespeedCvcvstartCvcvendCvcvvideovideocropvideoaudio_laudioaudio_raudioaudiocvgatepitch

inputs

cv_startgateGate signal (rising/falling edge).
cv_pausegateGate signal (rising/falling edge).
cv_resetgateGate signal (rising/falling edge).
cv_loop_togglegateGate signal (rising/falling edge).
asset_pitchpitchV/oct pitch CV.
asset_gategateGate signal (rising/falling edge).
speedCvcvCV -> speedCv param.
startCvcvCV -> startCv param.
endCvcvCV -> endCv param.

outputs

videovideovideo
cropvideovideo
audio_laudioAudio signal.
audio_raudioAudio signal.

params

speedlinear0..1
startlinear0..1
endlinear0..1
speedCvlinear-1..1(default 0)
startCvlinear-1..1(default 0)
endCvlinear-1..1(default 0)
cv_startlinear0..1(default 0)
cv_pauselinear0..1(default 0)
cv_resetlinear0..1(default 0)
cv_loop_togglelinear0..1(default 0)
asset_pitchlinear-10..10(default 0)
asset_gatelinear0..1(default 0)
source · videovarispeed.ts

Plays one of YOUR installed instrument plugins (AU builds of your VSTs) as a first-class rack voice via the vst-bridge native helper — poly/gate/vel CV converted to sample-accurate MIDI in the worklet, plugin audio returned into the lane, native editor window on your machine.

vst instrumentpolypolyPitchGatepitchcvgategatevelcvout_laudioout_raudioaudiocvgatepitch

inputs

polypolyPitchGatepolyPitchGate
pitchcvControl voltage.
gategateGate signal (rising/falling edge).
velcvControl voltage.

outputs

out_laudioAudio signal.
out_raudioAudio signal.
source · vst-instrument.ts
wavecel sources

Stereo wavetable oscillator with morph, stereo spread, and a West-Coast wavefolder — a more advanced sibling of WAVETABLEVCO. MORPH scans the wavetable frame position, SPREAD widens the stereo image by reading NEIGHBOURING frames into progressively harder-panned taps (a wavetable spread, not a pitch detune — one shared phase), FOLD adds wavefolding harmonics. Ships factory wavetables and accepts runtime upload of E352-format WAV wavetables (frames ride the Y.Doc out to every rack-mate). The card offers a 3D wavetable visualization in addition to the standard scope view. A POLY input (polyPitchGate) accepts the 5-voice chord bus from MIDI LANE (mode=poly) or POLYSEQZ: when any lane is gated WAVECEL renders one wavetable voice per gated lane at that lane's pitch and sums them — the morph/spread/fold timbre is shared across all voices. With nothing patched to poly the mono `pitch` path runs unchanged. A per-voice amplitude ADSR (Attack / Decay / Sustain / Release) plus a BASE VOL knob shape each voice. GATING is decided by what is PATCHED: when the POLY bus OR the mono TRIGGER is connected, WAVECEL is a GATED voice — a lane/voice sounds only while it is gated-or-releasing, and a never-gated lane is SILENT (patching poly never auto-drones). When NEITHER is patched, WAVECEL is a continuous raw VCO. BASE VOL is a per-voice VCA FLOOR the envelope rides on top of: gain = base + (1-base)·env per ACTIVE voice — base=0 (the default) is pure ADSR (silent between notes), 0.5 floors at 0.5 and rises to 1.0 at the env peak, base=1 means the env does nothing (full gain while active). It applies ONLY to gated voices: the raw-VCO case (nothing patched) runs at unity independently of BASE, so the legacy continuous drone is byte-identical at every setting. In poly mode each lane's gate edge drives its own envelope (one envelope per voice, soft/click-safe retrigger — re-gating a still-releasing voice attacks from the current level, never pops); the mix is normalized over ACTIVE voices (1/sqrt(N)) so a sustain=0 held note doesn't pump the level and a releasing tail doesn't pop. The ADSR + BASE VOL params read live (continuous k-rate) across all stages, so a held chord rides sustain/release in real time and a fresh note attacks at the value present at its trigger moment. Edge detection is block-rate (retrigger granularity floor ≈ one audio block); connectedness (poly/trigger patched) is read from the live patch edges, not bus presence.

wavecelpitchpitchfmaudiomorph_cvcvspread_cvcvfold_cvcvpolypolyPitchGatetriggergateout_laudioout_raudioscope_outmono-videowave3d_outvideoaudiocvgatepitch

inputs

pitchpitchV/oct pitch CV.
fmaudioAudio signal.
morph_cvcvCV -> morph param.
spread_cvcvCV -> spread param.
fold_cvcvCV -> fold param.
polypolyPitchGatepolyPitchGate
triggergateMono TRIGGER gate for the per-voice amplitude ADSR (drives lane-0's envelope when POLY is unpatched). A level gate, not a pulse: rising edge = note-on (attack), falling edge = note-off (release). PATCHING this (or POLY) makes WAVECEL a GATED voice — silent until the first note, then base-floored (BASE VOL) once active; releasing tails finish. When neither this nor POLY is patched WAVECEL free-runs as a continuous raw VCO at unity (the legacy drone, byte-identical, independent of BASE VOL).

outputs

out_laudioAudio signal.
out_raudioAudio signal.
scope_outmono-videomono-video
wave3d_outvideovideo

params

tunest-36..36(default 0)
fine¢-100..100(default 0)
morphlinear0..1(default 0)
spreadlinear1..5(default 1)
foldlinear0..1(default 0)
attacks0.001..5(default 0.001)
decays0.001..5(default 0.1)
sustainlinear0..1(default 1)
releases0.001..5(default 0.005)
base_vollinear0..1(default 0)
source · wavecel.ts
wavesculpt sources

Hybrid 4-oscillator 3D video synth. Four wavetable "wall oscillators" sit on the faces of a 3D unit box, each emitting a colored wave ribbon (RED / GREEN / BLUE / ALPHA) that points into the box; a single user camera renders the scene, positioned via an XY pad (X/Y) and a HEIGHT slider (Z). Audio out is the sum of the four oscillators, each weighted by its per-osc ADSR and by camera↔source distance — the distance gain is the single source of truth shared by audio and visuals, so "closer = louder = bigger ribbon" stays consistent across both domains. Per oscillator: tune/fine, wavetable morph, stereo spread, wavefolder, thickness, and ADSR; camera zoom + Y-rotation shape the view. All four oscillators run in one worklet for a tight audio-rate path. Six cross-domain VIDEO WALL inputs (wall1–wall6) texture an upstream video module onto the six faces of the room (FRONT/BACK/LEFT/RIGHT/FLOOR/CEILING) seen from inside; each face has a TRANSPARENCY knob (0–100%) blending the wall over the scene and a DISTORT knob (0–1) that morphs the flat wall into a convex dome we look up into. Patch the video output back into a wall input for recursive video feedback.

wavesculptgate1gatepitch_cv1cvgate2gatepitch_cv2cvgate3gatepitch_cv3cvgate4gatepitch_cv4cvmorph1_cvcvmorph2_cvcvmorph3_cvcvmorph4_cvcvpos_xcvpos_ycvpos_zcvzoomcvrotcvscalecvwigglecvalpha_invideowall1videowall2videowall3videowall4videowall5videowall6videoLaudioRaudioout_redaudioout_grnaudioout_bluaudioout_alpaudiovideo_outmono-videoaudiocvgatepitch

inputs

gate1gateGate signal (rising/falling edge).
pitch_cv1cvControl voltage.
gate2gateGate signal (rising/falling edge).
pitch_cv2cvControl voltage.
gate3gateGate signal (rising/falling edge).
pitch_cv3cvControl voltage.
gate4gateGate signal (rising/falling edge).
pitch_cv4cvControl voltage.
morph1_cvcvCV -> morph1 param.
morph2_cvcvCV -> morph2 param.
morph3_cvcvCV -> morph3 param.
morph4_cvcvCV -> morph4 param.
pos_xcvCV -> pos_x param.
pos_ycvCV -> pos_y param.
pos_zcvCV -> pos_z param.
zoomcvCV -> zoom param.
rotcvCV -> rot param.
scalecvCV -> scale param.
wigglecvCV -> wiggle param.
alpha_invideovideo
wall1videovideo
wall2videovideo
wall3videovideo
wall4videovideo
wall5videovideo
wall6videovideo

outputs

LaudioAudio signal.
RaudioAudio signal.
out_redaudioAudio signal.
out_grnaudioAudio signal.
out_bluaudioAudio signal.
out_alpaudioAudio signal.
video_outmono-videomono-video
source · wavesculpt.ts

Wavetable oscillator that morphs saw -> square -> triangle -> sine across a 16-frame table.

wavetable vcopitchpitchfmaudiowavePoscvpmaudiotunecvfinecvfmAmountcvpmAmountcvaudioaudioaudiocvgatepitch

inputs

pitchpitchV/oct pitch input.
fmaudioAudio-rate FM input.
wavePoscvCV -> wavetable scan position.
pmaudioAudio signal.
tunecvCV -> tune param.
finecvCV -> fine param.
fmAmountcvCV -> fmAmount param.
pmAmountcvCV -> pmAmount param.

outputs

audioaudioMixed wavetable output.

params

tunest-36..36(default 0)
fine¢-100..100(default 0)
wavePoslinear0..1(default 0)
fmAmountlinear-1..1(default 0)
pmAmountlinear-1..1(default 0)
source · wavetable-vco.ts

modulation

911 eg modulation

911 Envelope Generator (moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). NOT a literal ADSR: a three-time-constant CONTOUR generator with a single sustain LEVEL. On S-trigger (gate high) it ATTACKS over T1 from 0 to the peak (1.0), INITIAL-DECAYS over T2 down to ESUS (the sustain level), then HOLDS at ESUS while the gate is held; on release (gate low) it FINAL-DECAYS over T3 back to 0. Trigger-close forces the T3 final-decay stage regardless of which stage was running, so a short trigger that releases mid-attack still decays over T3 from wherever it reached. T1 / T2 / T3 each span up to 10 s (log knobs); ESUS is a linear 0..1 level. Outputs the unipolar 0..1 contour on env plus an inverted tap (1 - env) on env_inv for ducking / sidechain modulation. CV inputs (t1_cv / t2_cv / t3_cv log-scaled, esus_cv linear) sweep each control. DSP is own-code: a clean-room exponential-segment contour generator (not a port of any moogafakkin schematic or copyleft source - permissive only). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

911 eggategatet1_cvcvt2_cvcvesus_cvcvt3_cvcvenvcvenv_invcvaudiocvgatepitch

inputs

gategateS-trigger / gate input. Rising edge starts the contour (ATTACK over T1); falling edge forces the FINAL DECAY (T3) regardless of the current stage.
t1_cvcvCV for T1 (attack time). Log-scaled: a -1..+1 sweep covers the param's full log range centered on the knob.
t2_cvcvCV for T2 (initial-decay time). Log-scaled, like T1.
esus_cvcvCV for ESUS (sustain level). Linear-scaled across 0..1.
t3_cvcvCV for T3 (final-decay time). Log-scaled, like T1.

outputs

envcvEnvelope contour output, unipolar 0..1.
env_invcvInverted envelope output (1 - env) for ducking / sidechain-style modulation.

params

t1s0.0001..10(default 0.01)
t2s0.0001..10(default 0.2)
esuslinear0..1(default 0.6)
t3s0.0001..10(default 0.4)
source · moog911.ts
911a trig delay modulation

911A Dual Trigger Delay (moogafakkin System 55 clone — categorized under Ports -> moogafakkin). Two trigger delays for staggering envelope generators. Each trigger input fires its output after a DELAY time (2 ms..10 s log). A MODE switch sets coupling: OFF (independent — trig1->out1, trig2->out2), PARALLEL (trig1 fires BOTH delays), SERIES (trig1 fires delay1->out1, whose pulse then fires delay2->out2). Own-code timing (clean-room). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

911a trig delaytrig1gatetrig2gateout1gateout2gateaudiocvgatepitch

inputs

trig1gateGate signal (rising/falling edge).
trig2gateGate signal (rising/falling edge).

outputs

out1gateGate signal (rising/falling edge).
out2gateGate signal (rising/falling edge).

params

delay1s0.002..10(default 0.1)
delay2s0.002..10(default 0.1)
modediscrete0..?(default 0)
source · moog911a.ts

912 Envelope Follower (moogafakkin System 55 clone — categorized under Ports -> moogafakkin). Tracks the amplitude envelope of an audio input and outputs it as a control voltage, plus a gate when the envelope is above threshold. SENSITIVITY sets the input drive; SMOOTHING sets how fast the envelope tracks (envelope-detector lowpass). Pure Web Audio (rectify -> lowpass -> CV; threshold -> gate). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

912 envelope followeraudioaudioenvcvgategateaudiocvgatepitch

inputs

audioaudioAudio signal.

outputs

envcvControl voltage.
gategateGate signal (rising/falling edge).

params

sensitivitylinear0..1(default 0.7)
smoothinglinear0..1(default 0.5)
source · moog912.ts
921a driver modulation

921A Oscillator Driver (moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). A CONTROL-VOLTAGE PROCESSOR, NOT a sound source: it generates the two control voltages on a bus that drive N slaved 921B oscillators — a frequency CV (freq_bus, V/oct, encoding pitch) and a pulse-width CV (width_bus, 0..1). The FREQUENCY pot is mapped onto V/oct by a two-position frequency-RANGE switch — SEMITONE (a tight 2-octave fine compass) or OCTAVE (a wide 12-octave coarse compass). Summing FREQ + WIDTH CONTROL INPUTS add onto the buses per-sample (freq_cv is a V/oct pitch cable that sums 1:1 onto freq_bus; width_cv sums onto width_bus). NO audio inputs and NO audio outputs — the outputs are CV cables that feed a 921B's freq_bus / width_bus. DSP is own-code: pure CV math (exponential frequency mapping + width passthrough), not a port of any moogafakkin schematic or copyleft source - permissive only. Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family). Ships together with the 921B (the 921A is meaningless without a slaved 921B).

921a driverfreq_cvpitchwidth_cvcvfreq_buscvwidth_buscvaudiocvgatepitch

inputs

freq_cvpitchV/oct pitch CV.
width_cvcvCV -> width param.

outputs

freq_buscvControl voltage.
width_buscvControl voltage.

params

frequencylinear-1..1(default 0)
freqRangediscrete1..2(default 1)
widthlinear0..1(default 0.5)
source · moog921a.ts
960 sequencer modulation

960 Sequential Controller (moogafakkin System 55 clone — categorized under Ports -> moogafakkin). A 3-row x 8-step analog step sequencer. Each column has a knob per row (24 step pots); on each advance every row outputs its current column value as CV (row1/row2/row3), scaled by that row's RANGE (x1/x2/x4). Steps advance on an external CLOCK input (rising edge) or, when unpatched, an internal RATE clock; CLOCK OUT pulses each advance. Per-column NORMAL/SKIP/STOP switches skip a column or halt the run; START/STOP gate inputs reset/halt. v1; per-step trigger jacks, third-row-controls-timing, x2 parallel outs + 1V/oct clock CV deferred. Own-code (forks the repo sequencer). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

960 sequencerclockgatestartgatestopgaterow1cvrow2cvrow3cvclock_outgateaudiocvgatepitch

inputs

clockgateGate signal (rising/falling edge).
startgateGate signal (rising/falling edge).
stopgateGate signal (rising/falling edge).

outputs

row1cvControl voltage.
row2cvControl voltage.
row3cvControl voltage.
clock_outgateGate signal (rising/falling edge).

params

rateHz0.1..20(default 2)
source · moog960.ts

992 Control Voltage Panel (moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). A passive CV summer/attenuator: four CV inputs each pass through a per-channel ATTENUATOR (0..1) into a common summing bus (cv_out). Channel 4 is SIGNAL-INVERTING — its attenuator subtracts from the sum — so the panel can both add and cancel control voltages. No audio path; pure CV math (own-code, permissive). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

992 control voltage panelcv1cvcv2cvcv3cvcv4cvcv_outcvaudiocvgatepitch

inputs

cv1cvControl voltage.
cv2cvControl voltage.
cv3cvControl voltage.
cv4cvControl voltage.

outputs

cv_outcvControl voltage.

params

atten1linear0..1(default 1)
atten2linear0..1(default 1)
atten3linear0..1(default 1)
atten4linear0..1(default 1)
source · moog992.ts
993 trig modulation

993 Trigger & Envelope Voltages Panel (moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). A passive routing patch-bay: two S-trigger inputs (FROM 1 / FROM 2) feed three trigger outputs, each output independently selecting OFF / FROM 1 / FROM 2 via its ROUTE switch; two envelope-CV inputs pass straight through to two envelope outputs. Routing logic only (own-code, permissive). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

993 trigtrig_from1gatetrig_from2gateenv_in1cvenv_in2cvtrig_out1gatetrig_out2gatetrig_out3gateenv_out1cvenv_out2cvaudiocvgatepitch

inputs

trig_from1gateGate signal (rising/falling edge).
trig_from2gateGate signal (rising/falling edge).
env_in1cvControl voltage.
env_in2cvControl voltage.

outputs

trig_out1gateGate signal (rising/falling edge).
trig_out2gateGate signal (rising/falling edge).
trig_out3gateGate signal (rising/falling edge).
env_out1cvControl voltage.
env_out2cvControl voltage.

params

route1discrete0..2(default 1)
route2discrete0..2(default 1)
route3discrete0..2(default 1)
source · moog993.ts
adsr modulation

Gate-triggered attack-decay-sustain-release envelope. Outputs CV.

adsrgategateattackcvdecaycvsustaincvreleasecvenvcvenv_invcvaudiocvgatepitch

inputs

gategateTriggers attack -> decay -> sustain on rising edge; release on falling.
attackcvCV -> attack param.
decaycvCV -> decay param.
sustaincvCV -> sustain param.
releasecvCV -> release param.

outputs

envcvEnvelope CV out (0..1).
env_invcvInverted envelope CV out: 1 - env (unipolar 0..1 flip). When env=0 (rest), env_inv=1; when env=peak=1, env_inv=0. Useful for ducking, reverse-modulation, and "sidechain"-style envelopes. Different operation from VCA.audio_inv (which is a sign flip on bipolar audio).

params

attacks0.001..10(default 0.005)
decays0.001..10(default 0.1)
sustainlinear0..1(default 0.7)
releases0.001..10(default 0.3)
source · adsr.ts
buggles modulation

Chaotic random voltage source — clean-room functional implementation of the Buchla / Make Noise wogglebug archetype. One roll of the dice per woggle tick, five correlated views of it. Internal "woggle clock" emits triggers at the RATE knob (0.1-50 Hz, log); outputs are SMOOTH (slewed random), STEPPED (sample-and-held), CLOCK (woggle gate), BURST (probabilistic clusters of 3-7 triggers) and RING (smooth × sub-osc ring-mod). RING is typed audio so it reaches the audio path, but its carrier is a QUARTER of the woggle rate and therefore SUB-AUDIO everywhere on the dial (0.025 Hz at the bottom, 0.30 Hz at spawn, 12.5 Hz flat out) — a slow shuddering product to modulate with, not a tone. CV inputs modulate rate + chaos; EXT CLK replaces the internal scheduler when patched. The "Wogglebug" name is Make Noise's trademark — BUGGLES is our name; no proprietary schematic is copied.

bugglesclock_cvcvchaos_cvcvexternal_clockgatesmoothcvsteppedcvclockgateburstgateringaudioaudiocvgatepitch

inputs

clock_cvcvCV → woggle rate. Sums onto the RATE knob value (clamped to 0..1, then log-mapped to 0.1..50 Hz).
chaos_cvcvCV → chaos amount. Sums onto the CHAOS knob (clamped to 0..1).
external_clockgateGate input. When patched and pulsing, replaces the internal woggle scheduler — every rising edge advances state. Detected on the main thread through the shared windowed edge counter, polled every 33 ms, so external clocks above ~30 Hz coalesce into one woggle event per poll.

outputs

smoothcvSlowly-shifting random voltage (-1..+1). The STEPPED value, slewed via linearRampToValueAtTime; SMOOTH knob controls slew duration.
steppedcvSample-and-held random voltage (-1..+1). Updates instantly on each woggle event. CHAOS knob controls correlation between successive steps (0=walk, 1=independent).
clockgate5ms gate pulse fired on each woggle event. Use as a chaotic clock for sequencers / drum triggers.
burstgateCluster of 3-7 closely-spaced 4ms gate pulses, fired at probability BURST per woggle event. Probabilistic chaos — sometimes silent, sometimes a buzz of triggers.
ringaudioRing-modulation output: SMOOTH voltage × sine sub-oscillator at rate/4. Typed audio so it reaches the audio path, but the carrier is SUB-AUDIO at every knob position — 0.025 Hz at the bottom of RATE, 0.30 Hz at spawn, 12.5 Hz flat out, against a ~20 Hz floor of hearing. A slow shuddering product to modulate with, not a tone.

params

ratelinear0..1(default 0.4)
chaoslinear0..1(default 0.3)
smoothnesslinear0..1(default 0.5)
burst_probabilitylinear0..1(default 0.2)
levellinear0..1(default 0.7)
source · buggles.ts
cartesian modulation

4x4 grid sequencer. Steps via clock; X/Y CV inputs scrub freely across the grid. An upper-right S&H toggle (ON by default) bakes in a gate-sampled Sample & Hold on the pitch CV: in the clock-UNPATCHED X/Y-tracking mode the pitch+gate re-emit is suppressed while the prior gate is still high, so the pitch CV latches to the gate edge and holds (the visual playhead still tracks continuously). The clock-PATCHED mode is already gate-sampled. S&H applies to PITCH only — the free-running quadrature LFO (lfo_x/lfo_y) is never held. Turn S&H OFF for legacy continuous re-emit on every pad change.

cartesianclockgatex_cvcvy_cvcvlfo_clockgatepitchpolyPitchGategategateclockgatelfo_xcvlfo_ycvaudiocvgatepitch

inputs

clockgateStep advance (rising edge).
x_cvcvCV scrub on the X axis.
y_cvcvCV scrub on the Y axis.
lfo_clockgateGate signal (rising/falling edge).

outputs

pitchpolyPitchGateV/oct pitch out.
gategateGate out.
clockgateStep advance (rising edge).
lfo_xcvControl voltage.
lfo_ycvControl voltage.

params

octavediscrete-2..2(default 0)
gateLengthlinear0.1..0.95(default 0.5)
lfoDivdiscrete0..7(default 3)
lfoShapelinear0..3(default 0)
snhdiscrete0..1(default 1)
source · cartesian.ts
clip player modulation

CLIP PLAYER — an Ableton-Session-style clip launcher with 8 INSTRUMENT LANES. Rotates Ableton's layout 90° to sit on a wide monome grid: ROWS = 8 instruments (lanes), COLUMNS = 8 clip slots per instrument (64 note clips total). Each lane plays its launched clip out its OWN pitch/gate/velocity outputs, so up to 8 clips sound at once — one per instrument (the owner model: "each row reflects a given instrument's materials"). It is a companion to a monome grid 128 controller AND to a one- or two-unit Novation Launchpad Mini Mk3 (both browser-native — WebSerial for the grid, WebMIDI for the Launchpad, no native helper — see lib/control/monome + lib/control/launchpad) but is fully usable from the card alone. CLOCK: LOCKED TO TIMELORDE (the rack transport) — no internal BPM, no clock cable. It runs only while TIMELORDE.running, at TIMELORDE.bpm, and freezes when it stops (free-runs if no TIMELORDE is in the rack). The only timing control is STEP (1/4 · 1/8 · 1/16 (default) · 1/32 = steps-per-beat). The card's ▶/■ transport writes TIMELORDE.running, and HIDES itself when TIMELORDE is slaved to an external clock (MIDICLOCK → start_in/stop_in). LAUNCH: clicking a clip queues it; with QNT on (default) it takes over on that lane's next loop boundary (off = immediately). Each lane queues independently, so a whole new arrangement can drop in on the bar line. A "scene" is a COLUMN — firing it launches one clip per instrument together. The per-lane playing/queued set syncs over the Y.Doc so collaborators (and a second grid) see the same session; grid LED + serial I/O stay per-user local. CLIPS are tiny note/step patterns (default 16 steps, up to 128 — set non-destructively, so notes past a shortened length are kept and replay when you lengthen again): polyphonic (chords fan out across the lane's poly pitch/gate pairs), per-note length (held gates), per-note velocity (drives the lane's vel CV), per-note probability, and scale-aware (major/minor/pentatonic/chromatic). Clips may be DIFFERENT lengths per lane; lanes free-run as a POLYMETER and all re-align to step 0 on the TIMELORDE transport downbeat (a fresh ▶ is always phase-locked). CARD: a SESSION view (8×8 launch grid, lane-tinted; single-click = launch/queue, click the playing cell = stop, DOUBLE-CLICK = open the clip's editor) and an EDIT view (a piano-roll note editor — X = step, Y = pitch in-key; click a cell to place/remove a note, right-click to cycle its velocity through 6 levels (≈0/20/40/60/80/100%), with scale/root/length controls, per-lane MONO/POLY, ROW/OCT pitch-window scroll + a TIMELORDE-locked playhead). GRID (16×8): left 8×8 = clip matrix, right control strip = per-lane STOP + SCENE launch + COPY/PASTE/PASTE-REVERSE (held modifiers: hold COPY/PASTE/PASTE-REV + tap a clip to copy it to / paste it from a per-machine buffer; PASTE-REV pastes a time-reversed copy) + STOP-ALL + TRANSPORT; HOLD the EDIT pad + tap a clip to turn the whole grid into that clip's note editor. The on-grid note editor pages a clip in up to 8 pages of 16 steps — FOLLOW auto-scrolls the shown page with the playhead, tap it to FREEZE and page with LEFT/RIGHT; DOUBLE dups the first half into a doubled length; a dedicated 2-row LENGTH page sets the clip length (block ×16 then trim to the exact end step). LAUNCHPAD (Novation Launchpad Mini Mk3, one or two units over WebMIDI): the same clip matrix + note editor, plus a command deck exposing per-lane MONO / MUTE / clock-RATE / SWING / per-clip CLIP-DIV, a RESET pad, tempo nudge, and a KEYS isomorphic keyboard for live note entry + clip-record. Its scene-launch column is a SCROLLING window (shift-layer amber UP/DOWN) reaching up to 64 scene slots per lane — FIXED stride-64 clip storage means clips can live in scenes past the first 8 (older saves migrate once on load) — and a TYPED clipboard COPY/PASTEs whole SCENES (all 8 lanes at a slot, full-replace) as well as single clips: scene→scene and clip→clip apply, the cross-type pastes are no-ops with dimmed targets, and a scene paste is one undo step. SCENE REPEATS (Deluge-style): scenes loop forever by default (repeats = infinite), but HOLD GRID + HOLD a scene-launch button (position-relative through the scene scroll) to open the orange REPEAT-COUNT view — tap pad k to set k repeats (1–63; pad 64 = infinite; pads 1..N stay lit for count N, all 64 = infinite) — and after N passes of the scene's longest clip (frozen at launch) the player auto-launches the next content scene down through the normal quantized launch path, skipping empty rows and keeping the last content scene looping; manual launches always win (relaunching resets the count, an individual clip launch cancels it), muting never voids it, whole-scene COPY/PASTE carries the count with the scene, and the card shows a read-only "×N" flair (live "p/N" while counting) at the right of each scene row. PER-CLIP AUTOMATION (Deluge-like): right-click a MODULE'S CARD → "Assign to automation lane" (1–8; MODULE-level — one lane per module, re-assigning moves it; the assigned card gets a thin border in the lane's colour and the AUTO block shows per-lane assigned-module counts), then arm THAT LANE's teal ◉ (per-lane arm, under its channel column next to RATE; on a Launchpad, SHIFT+the lane's top-row button, lane 8 = double-tap SHIFT) — while a lane is armed and its note clip plays, TOUCHING any control of a module assigned to it (screen / MIDI / Electra — NEVER CV: automation records your hands, a CV cable is performance signal and is never captured) records by CONTINUOUS OVERDUB into the PLAYING clip's OWN automation (punch-in at that clip's next loop start; each clip in a lane carries its own envelopes, stored beside the notes so note edits never clobber them; only moved params are written, max 16 recorded controls per clip; touching an unassigned module's control records nothing — assignment is explicit; per-lane single-writer, so two collaborators can record two lanes at once). Launching a clip launches its envelopes with it (linked to the clip's length); the ENVELOPE BELONGS TO THE CLIP — copy/paste + scene-duplicate carry it (PASTE-REV time-reverses it), pasting over a clip replaces it, clearing/emptying a clip clears it, carriers show a teal dot on their cell, and if two lanes' clips automate the same control exactly ONE drives it (its module's assigned lane wins, else lowest). Deletion is explicit + undoable: right-click → "Clear recorded automation" (per control; distinct from the module menu's "Remove automation assignment", which only stops future recording) and the editor's CLR AUTO (per clip). Playback is transient on every peer and never rewrites the saved patch; grabbing an automated control suspends its automation until you physically release it, and the on-card override dot re-enables all. Two current limits: the on-card grid shows only the first 8 scenes (card scene-scroll is a follow-up), and the arranger records session launches of scenes 1–8 (scene 9+ arranger recording is a follow-up). Inputs — STOP ALL: a rising edge stops every lane (canonical windowed edge counter, no double-count). Outputs — PITCH 1-8: each lane's launched-clip pitch as a poly-capable V/oct cable (chords fill lanes), GATE 1-8: high while that lane's note sounds, VEL 1-8: that lane's per-note velocity as a 0..1 CV (patch into a VCA/ADSR amount). Params — STEP (steps per beat), OCT (octave transpose), GATE (per-step gate duty cycle), QNT (quantize launch to the loop boundary), S&H (ON by default). The upper-right S&H toggle bakes in a gate-sampled Sample & Hold across ALL 8 lanes at once — replacing the 8 external S&H modules a user otherwise needs: on a REST (empty step) the lane's gate still closes but its pitch CV HOLDS its last value instead of resetting to C4, so each lane's pitch latches to the gate edge. Turn S&H OFF for the legacy continuous behavior where rests rewrite pitch. SONG MODE (arranger): the header SES/ARR toggle flips between live SESSION play and ARRANGEMENT playback of a recorded TIMELINE of clip launches (an event log over song-beats). The ● REC arm captures launches into that timeline; the RPL/OVR toggle next to it sets the record mode — REPLACE (default: arming clears the log + restarts the song at bar 1) or OVERDUB (arming KEEPS the existing take and merges new launches into it by song-beat). In ARRANGEMENT view the card shows a compact lane×bar timeline whose clip blocks can be DRAGGED in time (bar-snapped) to retime a launch, selected to cycle/delete, with the loop length nudged in bars. The "ARR ⤢" button pops out a FULL-WINDOW arranger editor (like the MAPPY map editor) hosting a large timeline with the same drag-to-move + all the edit ops + a SNAP bar/beat toggle; it reads/writes the SAME synced arrangement so the card, the pop-out, and peers stay in lock-step. The arrangement is Y.Doc-synced; drags commit one transactional write on drop (no per-frame store churn). All ports live on the yellow drill-down PATCH PANEL (no side jacks); knobs are MIDI / control-surface assignable. Usage: build a few note clips per instrument, patch each lane's PITCH/GATE into its own voice, start TIMELORDE, then launch/quantize-switch clips + scenes from the card (or a monome grid) to perform, RECORD a take into the arrangement (REPLACE or OVERDUB) and refine it by dragging blocks on the timeline (in-card or the pop-out editor). A faithful monome Kria step-sequencer ships as the separate `kria` module.

clip playerstop_allgateresetgatepitch1polyPitchGategate1gatevel1cvpitch2polyPitchGategate2gatevel2cvpitch3polyPitchGategate3gatevel3cvpitch4polyPitchGategate4gatevel4cvpitch5polyPitchGategate5gatevel5cvpitch6polyPitchGategate6gatevel6cvpitch7polyPitchGategate7gatevel7cvpitch8polyPitchGategate8gatevel8cvaudiocvgatepitch

inputs

stop_allgateGate signal (rising/falling edge).
resetgateGate signal (rising/falling edge).

outputs

pitch1polyPitchGatepolyPitchGate
gate1gateGate signal (rising/falling edge).
vel1cvControl voltage.
pitch2polyPitchGatepolyPitchGate
gate2gateGate signal (rising/falling edge).
vel2cvControl voltage.
pitch3polyPitchGatepolyPitchGate
gate3gateGate signal (rising/falling edge).
vel3cvControl voltage.
pitch4polyPitchGatepolyPitchGate
gate4gateGate signal (rising/falling edge).
vel4cvControl voltage.
pitch5polyPitchGatepolyPitchGate
gate5gateGate signal (rising/falling edge).
vel5cvControl voltage.
pitch6polyPitchGatepolyPitchGate
gate6gateGate signal (rising/falling edge).
vel6cvControl voltage.
pitch7polyPitchGatepolyPitchGate
gate7gateGate signal (rising/falling edge).
vel7cvControl voltage.
pitch8polyPitchGatepolyPitchGate
gate8gateGate signal (rising/falling edge).
vel8cvControl voltage.

params

stepDivdiscrete0..3(default 2)
octavediscrete-2..2(default 0)
gateLengthlinear0.1..1(default 0.9)
quantizediscrete0..1(default 1)
snhdiscrete0..1(default 1)
restrictRangediscrete0..1(default 0)
rangeFloordiscrete0..8(default 3)
source · clipplayer.ts
feature cv modulation

FEATURECV — an audio→CV feature extractor. Takes ONE audio input and turns the WHOLE signal's timbre + dynamics into control voltages plus an onset trigger, time-domain only (no FFT) so it is fully deterministic. Deliberately distinct from SYNESTHESIA (per-band energy/gates/onsets); featurecv analyses the broadband signal. Features — LOUD (cv): broadband RMS = overall loudness/energy. BRIGHT (cv): zero-crossing rate, a cheap spectral-brightness proxy (high = hissy/trebly, low = dark/bassy). PUNCH (cv): crest factor (peak ÷ RMS) = how spiky/transient vs sustained/compressed. ONSET (gate, edge=trigger): a short pulse that fires ONCE on each fresh attack/transient (time-domain spectral-flux peak-pick with an adaptive threshold + debounce). The three feature CVs are emitted BIPOLAR (−1..+1) by DEFAULT so a strong feature sweeps a knob-centred destination's FULL range; the POLARITY toggle switches to UNIPOLAR (0..1) for envelope-style modulation. Controls — GAIN: input trim into the analyser (×0.25..×4 log, unity at noon). ATK / REL: attack + release smoothing (ms, log) of the three feature CVs. POLARITY: BI [-1,+1] (default) / UNI [0,1]. SENS: onset sensitivity (linear; higher fires on smaller transients). DEBNCE: onset debounce (ms, log; minimum gap between triggers), which is a RATE CEILING of 1000÷ms — 12.5 Hz at the shipped 80 ms. Three measured facts the dials cannot print, and the faceplate does: the three feature CVs REST at −1.00 (bipolar) with nothing patched, not at 0; GAIN reaches only LOUD, because ZCR and crest are both scale-invariant; and LOUD PINS at full scale above −6.02 dBFS RMS at unity trim. DSP is own-code (clean-room) in packages/dsp/src/lib/featurecv-dsp.ts, reusing the synesthesia EnvFollower one-pole + applyBipolar + the time-domain flux-onset idea; the worklet wraps it (the SYNESTHESIA/SPECTROGRAPH analyser pattern: GAIN GainNode → worklet → per-feature output GainNodes + a muted keep-alive so process() runs while outputs are unpatched). The legacy card shows live LOUD/BRIGHT/PUNCH meters + an ONSET blink (display only — never writes the live Y.Doc); the FACEPLATE replaces them with the three drawn maps, because the snapshot behind those bars is the UNSMOOTHED, always-unipolar target and disagrees with the jacks it names. All patching is via the card's yellow drill-down PATCH PANEL — no side jacks; every knob is MIDI / control-surface assignable. Usage: patch LOUD into a VCA/filter to track dynamics, BRIGHT into a filter cutoff so the timbre opens as the source brightens, PUNCH into modulation that should react to transients, and ONSET into an envelope generator or drum voice to fire on each hit.

feature cvinaudioloudcvbrightcvpunchcvonsetgateaudiocvgatepitch

inputs

inaudioAudio signal.

outputs

loudcvControl voltage.
brightcvControl voltage.
punchcvControl voltage.
onsetgateGate signal (rising/falling edge).

params

gainlog0.25..4(default 1)
attackms0.5..500(default 10)
releasems1..2000(default 100)
bipolardiscrete0..1(default 1)
onset_senslinear0..1(default 0.5)
onset_debouncems20..1000(default 80)
source · featurecv.ts
kria modulation

KRIA — a 4-track grid step-sequencer, a clean-room reimagining of monome's Kria (inspired by monome Kria; behavior reimplemented from monome's public docs, no monome source or doc prose reproduced). Like CLIP PLAYER it is a browser-native companion to a monome grid 128 (WebSerial, no native helper — see lib/control/monome) but is FULLY usable from the card with a mouse. MODEL: four INDEPENDENT tracks, each with its own per-step sequences edited on separate PAGES selected from a nav row. LANES, each edited on the same 7×16 grid and picked from a nav row: TRG (does the step fire?), NTE (the Y axis picks a pitch DEGREE within the active scale), OCT (per-step +0..+5 octave offset), DUR (per-step gate length as a fraction of the step), PRB (per-step probability, Kria's 4-level fader), GLD (per-step pitch slew) and RAT (per-step ratchet, 1-4 sub-hits). A lane with fewer values than the grid has rows leaves the surplus rows visibly INERT rather than taking clicks it cannot display. Per-track: LOOP (start + length, wrapping), TIME (clock DIVISION — advance once every N base ticks), DIRECTION (forward / reverse / pingpong / drunk / random) and MUTE. A shared SCALE (major / minor / pentatonic / chromatic) maps NOTE degrees to V/oct. 16 PATTERN slots each hold a full snapshot of all four tracks; switching patterns is QUANTIZED — tap a slot to CUE it and the engine swaps it in on the next track-0 loop boundary (or after a cue-clock countdown). CLOCK: locks to the rack's TIMELORDE singleton (runs only while TIMELORDE.running, tempo = TIMELORDE.bpm); patch an external CLOCK IN to override the tempo (each rising edge advances the base grid, via the canonical windowed edge counter — no double-count), and a RESET IN rising edge re-anchors every track to its loop start. Without a TIMELORDE node the card's BPM knob + RUN button drive it. SURFACE: a TRACK selector (1-4), a LANE selector (TRG/NTE/OCT/DUR/PRB/GLD/RAT + PAT), a 16-step editor for the selected track+lane (with a clock-locked playhead column), a 16-slot pattern strip (tap empty = create + activate, tap another = cue a quantized switch), the per-track LOOP / TIME / DIRECTION / MUTE controls and the pattern-level SCALE + ROOT; a GRID button connects + binds a monome grid (capability-gated, Chromium) so the same edits + cues happen on hardware with live varibright LED feedback. Under the workflow shell the same instrument is a FACEPLATE: the step grid is the dock hero picture and everything per-track is a band cell, reading and writing through the same helpers the card calls. Inputs — CLOCK IN (external clock, rising edge advances), RESET IN (rising edge re-anchors all tracks). Outputs (the Ansible Kria shape) — PITCH 1-4 (per-track V/oct with per-step glide slew) + GATE 1-4 (per-track gates; DURATION shapes the width, ratchet subdivides). All ports live on the yellow drill-down PATCH PANEL (no side jacks); the BPM knob is MIDI / control-surface assignable. USAGE: patch each track's PITCH+GATE into a voice (VCO + VCA/ADSR), clock from TIMELORDE, build patterns lane by lane per track from the card, the faceplate or a monome grid, then perform by cueing pattern slots for quantized arrangement changes.

kriaclockgateresetgatepitch1pitchgate1gatepitch2pitchgate2gatepitch3pitchgate3gatepitch4pitchgate4gateaudiocvgatepitch

inputs

clockgateGate signal (rising/falling edge).
resetgateGate signal (rising/falling edge).

outputs

pitch1pitchV/oct pitch CV.
gate1gateGate signal (rising/falling edge).
pitch2pitchV/oct pitch CV.
gate2gateGate signal (rising/falling edge).
pitch3pitchV/oct pitch CV.
gate3gateGate signal (rising/falling edge).
pitch4pitchV/oct pitch CV.
gate4gateGate signal (rising/falling edge).

params

bpmlinear30..300(default 120)
runningdiscrete0..1(default 0)
source · kria.ts
lfo modulation

Clockable LFO with four phase outputs (0deg / 90deg / 180deg / 270deg).

lfoclockgateratecvshapecvdepth_cvcvphase0cvphase90cvphase180cvphase270cvaudiocvgatepitch

inputs

clockgateExternal clock - locks LFO rate to incoming pulses.
ratecvCV -> rate AudioParam.
shapecvCV -> wave shape.
depth_cvcvCV -> depth param.

outputs

phase0cvLFO at 0deg.
phase90cvLFO at 90deg.
phase180cvLFO at 180deg.
phase270cvLFO at 270deg.

params

rateHz0.01..100(default 1)
shapelinear0..2(default 0)
depthlinear0..1
source · lfo.ts
nine lives modulation

LFO with NINE CV outputs on a geometric 1/3 rate ladder + a reset trigger. out1 runs at the Rate knob; each subsequent output is 1/3 the rate of the previous, so out_n = rate * (1/3)^(n-1) — out2 = rate/3, out3 = rate/9, ... out9 = (1/3)^8 = rate/6561 (~0.0001524x). At the shipped Rate of 1 Hz that is 1.00 s per cycle on out1 and 1.8 HOURS on out9, so the bottom of the ladder reads as DC rather than as modulation — that is the module working, not a dead jack. All nine taps share ONE Waveform morph (sine -> saw -> square) and are fixed full-scale +/-1: there is no depth control, so attenuate downstream. out1 is bit-identical to a normal LFO only at that LFO default Depth of 0.5, where its own Depth*2 scaling reaches unity. A rising edge on RESET re-zeroes every phase so all outputs re-sync to phase 0 together. Ports live on the yellow drill-down PATCH PANEL (no raw side jacks).

nine livesresetgateout1cvout2cvout3cvout4cvout5cvout6cvout7cvout8cvout9cvaudiocvgatepitch

inputs

resetgateGate signal (rising/falling edge).

outputs

out1cvControl voltage.
out2cvControl voltage.
out3cvControl voltage.
out4cvControl voltage.
out5cvControl voltage.
out6cvControl voltage.
out7cvControl voltage.
out8cvControl voltage.
out9cvControl voltage.

params

rateHz0.01..100(default 1)
shapelinear0..2(default 0)
source · ninelives.ts
score modulation

Sheet-music sequencer. A treble-clef staff of 16 bars per page, up to 4 pages, in 4/4 — click to place notes. Outputs pitch / gate / env (ADSR x dynamic) / clock.

scoreplay_cvgatereset_cvgatequeue1_cvgatequeue2_cvgatequeue3_cvgatequeue4_cvgateclockgateattackcvdecaycvsustaincvreleasecvpitchpitchgategateenvcvclockgateaudiocvgatepitch

inputs

play_cvgateGate signal (rising/falling edge).
reset_cvgateGate signal (rising/falling edge).
queue1_cvgateGate signal (rising/falling edge).
queue2_cvgateGate signal (rising/falling edge).
queue3_cvgateGate signal (rising/falling edge).
queue4_cvgateGate signal (rising/falling edge).
clockgateExternal 16th-rate clock; rising edges advance one slot. Disconnect -> internal BPM.
attackcvCV -> ADSR attack.
decaycvCV -> ADSR decay.
sustaincvCV -> ADSR sustain.
releasecvCV -> ADSR release.

outputs

pitchpitchV/oct pitch out (mono).
gategateGate out, held for the notated duration of each note.
envcvEnvelope out: ADSR x dynamic (mf=0.55, ff=1.045 — the one marking that pushes ENV above unity).
clockgateExternal 16th-rate clock; rising edges advance one slot. Disconnect -> internal BPM.

params

bpmlinear30..300(default 120)
attacks0.001..10(default 0.005)
decays0.001..10(default 0.1)
sustainlinear0..1(default 0.7)
releases0.001..10(default 0.3)
isPlayingdiscrete0..1(default 0)
source · score.ts
timelorde singleton modulation

Singleton master clock. Internal or external BPM, twelve clock-divider outputs. Its two transport controls name their own states — RUNNING / STOPPED beside GATES LIVE / MUTED — because a stopped clock and a muted one are silent in exactly the same way at all thirteen jacks, so seeing both is the only way to tell which one is silencing your rack. A TAP pad sets the tempo by ear: tap twice in time to lock the BPM, keep tapping to refine it (median of the recent intervals, ~2s timeout starts a fresh count); the Spacebar taps it too while TIMELORDE is the selected node. TAP does nothing while an external clock is patched into CLOCK IN — the measured external tempo owns the BPM then, and your own setting is put aside and handed back when you pull the cable out. The big display shows the owl painting whose YELLOW EYES and BLUE BORDER brighten in time with the beat (the body stays steady); patch a feed into VIDEO IN and it becomes a live monitor while VIDEO OUT passes the feed through (TIMELORDE can sit inline in a video chain). A SCREEN switch hides the display to reclaim its space — the picture keeps being made either way, so VIDEO OUT never goes dark.

timelorde · singletonclockgatestart_ingatestop_ingategategatevideo_invideo1xgate8xgate4xgate2xgate1/2gate1/3gate1/4gate1/8gate1/12gate1/16gate1/32gate1/64gateswinggatevideo_outvideoaudiocvgatepitch

inputs

clockgateExternal clock - snaps 1x to incoming rising edges; falls back to internal BPM after ~2 master periods.
start_ingateGate signal (rising/falling edge).
stop_ingateGate signal (rising/falling edge).
gategateLevel-sensitive show/hide for the beat-pulsing owl display. HIGH = owl on, LOW = off (same on/off state as the on-card owl button).
video_invideoPatch a video feed here and the big card display becomes a LIVE MONITOR of it (the owl steps aside); also routed to video_out so TIMELORDE passes the feed through inline. Unpatched = the owl shows.

outputs

1xgateMaster tempo gate.
8xgateGate signal (rising/falling edge).
4xgateGate signal (rising/falling edge).
2xgateGate signal (rising/falling edge).
1/2gateGate signal (rising/falling edge).
1/3gateGate signal (rising/falling edge).
1/4gateGate signal (rising/falling edge).
1/8gateGate signal (rising/falling edge).
1/12gateGate signal (rising/falling edge).
1/16gateGate signal (rising/falling edge).
1/32gateGate signal (rising/falling edge).
1/64gateGate signal (rising/falling edge).
swinggateGate signal (rising/falling edge).
video_outvideoThe picture the big display shows — the live VIDEO IN feed when one is patched, else the beat-pulsing owl. Lets TIMELORDE sit inline in a video chain (in -> display -> out).

params

bpmbpm10..300(default 120)
swingAmountdeg0..90(default 0)
swingSourcediscrete0..11(default 0)
muteOutputsdiscrete0..1(default 0)
runningdiscrete0..1(default 1)
wizardOndiscrete0..1(default 1)
source · timelorde.ts

filters

904a vcf filters

904A Voltage Controlled Low Pass Filter (slice 2 of the moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). The classic moogafakkin transistor-LADDER low-pass filter, 24 dB/oct. Cutoff is set by the FIXED CONTROL VOLTAGE (Cutoff) pot, shifted in 2-octave steps by the RANGE switch (1/2/3 = x1/x4/x16), and swept by the summing 1V/oct CONTROL INPUT (cutoff_cv — each volt = one octave, summed per-sample). REGENERATION is the variable Q / internal feedback: at low settings it is a clean low-pass; turned toward max it sharpens into a strong resonant peak and SELF-OSCILLATES into a clean sine VC oscillator at the cutoff frequency (reso_cv modulates it). Signature moogafakkin growl comes from a tanh saturation per ladder stage that also self-limits the resonance so it stays bounded. DSP is own-code, CLEAN-ROOM: a TPT/Zavalishin zero-delay-feedback ladder (stable under audio-rate cutoff modulation) re-derived from the unpatented textbook algorithm plus the Huovilainen tanh-per-loop technique — NOT a port of the LGPLv3 Huovilainen code, the CC-BY-SA musicdsp model, or any moogafakkin schematic (permissive only). The shared moog-ladder-dsp lib it is built on is reused by the 904B (HPF) + 904C (coupler) in later slices. Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

904a vcfaudioaudiocutoff_cvcvreso_cvcvaudioaudioaudiocvgatepitch

inputs

audioaudioSignal in (the audio to filter) / 24 dB/oct low-pass out (self-oscillating sine near regeneration=1).
cutoff_cvcvSumming 1V/oct CONTROL INPUT. Each volt shifts the cutoff one octave; summed onto the Cutoff knob + RANGE per-sample in the worklet (PASSTHROUGH_BY_DESIGN — the worklet owns the exponential map + clamp).
reso_cvcvREGENERATION CV. Summed onto the Regen knob per-sample in the worklet (PASSTHROUGH_BY_DESIGN — clamped 0..1); push toward 1 to drive self-oscillation.

outputs

audioaudioSignal in (the audio to filter) / 24 dB/oct low-pass out (self-oscillating sine near regeneration=1).

params

cutoffHz20..20000(default 1000)
rangediscrete1..3(default 2)
regenerationlinear0..1(default 0)
source · moog904a.ts
904b vcf filters

904B Voltage Controlled High Pass Filter (moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). The high-pass companion to the 904A LPF: a 24 dB/oct transistor-LADDER HIGH-pass, built (like the hardware) by SUBTRACTING the ladder's low-passed signal from the input (input - lp4 -> the complementary 4-pole high-pass). Cutoff is set by the FIXED CONTROL VOLTAGE (Cutoff) pot, shifted by a two-position RANGE switch (LOW = the full 4 Hz–20 kHz span / HIGH = +1.5 octaves), and swept by the summing 1V/oct CONTROL INPUT (cutoff_cv — each volt = one octave, summed per-sample). Unlike the 904A there is NO regeneration / resonance knob (the hardware 904B has no resonance pot), so the ladder runs with zero feedback. DSP is own-code, CLEAN-ROOM: it CONSUMES the same shared transistor-ladder core the 904A uses (TPT/Zavalishin zero-delay-feedback ladder via its hpDerive high-pass tap) — NOT a port of the LGPLv3 Huovilainen code, the CC-BY-SA musicdsp model, or any moogafakkin schematic (permissive only). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

904b vcfaudioaudiocutoff_cvcvaudioaudioaudiocvgatepitch

inputs

audioaudioAudio signal.
cutoff_cvcvCV -> cutoff param.

outputs

audioaudioAudio signal.

params

cutoffHz4..20000(default 1000)
rangediscrete1..2(default 1)
source · moog904b.ts

904C Voltage Controlled Filter Coupler (moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). Chains an internal moogafakkin-ladder low-pass + high-pass into a CV-controlled BAND-PASS / band-reject: CUTOFF, WIDTH (LP/HP spread) and MODE (BP to BR) knobs plus a 1V/oct cutoff CV input. DSP composes two ladder instances (own-code clean-room ladder). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

904c voltage controlled filter coupleraudioaudiocutoff_cvcvaudioaudioaudiocvgatepitch

inputs

audioaudioAudio signal.
cutoff_cvcvCV -> cutoff param.

outputs

audioaudioAudio signal.

params

cutoffHz20..20000(default 800)
widthlinear0..1(default 0.5)
modelinear0..1(default 0)
source · moog904c.ts

907A Fixed Filter Bank (moogafakkin System 35 clone — categorized under Ports -> moogafakkin). Non-VC fixed filter bank: a high-pass + low-pass + several fixed center-frequency band-pass cells (12 dB/oct), each with its own level knob, summed to one output. Shares the moog-filterbank center-frequency lib with the 914. Own-code (textbook biquad bank). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

907a fixed filter bankaudioaudioaudioaudioaudiocvgatepitch

inputs

audioaudioAudio signal.

outputs

audioaudioAudio signal.

params

hplinear0..1(default 0.5)
lplinear0..1(default 0.5)
source · moog907a.ts

914 Extended-Range Fixed Filter Bank (moogafakkin System 55 clone — categorized under Ports -> moogafakkin). The extended fixed filter bank: 1 high-pass + 1 low-pass + 12 fixed center-frequency band-pass cells (12 dB/oct), each level-knob-controlled, summed to one output. Shares the moog-filterbank center-frequency lib with the 907A. Own-code (textbook biquad bank). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

914 extended fixed filter bankaudioaudioaudioaudioaudiocvgatepitch

inputs

audioaudioAudio signal.

outputs

audioaudioAudio signal.

params

hplinear0..1(default 0.5)
lplinear0..1(default 0.5)
source · moog914.ts
filter filters

Multi-mode resonant VCF — three 2-pole (12 dB/oct) Faust sections running in parallel with a MODE switch picking one: 0 = LOWPASS, 1 = HIGHPASS, 2 = BANDPASS (that order, not LP/BP/HP). CUTOFF 20 Hz-20 kHz log; RES 0..0.99 mapped to Q = res x 20 + 0.7, so maximum resonance peaks ~26 dB over a unity passband — it rings hard but never self-oscillates. Two CV jacks, each with its own attenuverter knob: cutoff CV is exponential (+/-1 = +/-5 octaves around the knob at full depth, clamped to the 20 Hz-20 kHz window), res CV is additive on the 0..0.99 scale. Both CV values pass the DSP's ~7 Hz one-pole smoother, so this is an envelope/LFO modulation input, not an audio-rate FM input.

filteraudioaudiocutoffcvrescvaudioaudioaudiocvgatepitch

inputs

audioaudioAudio in.
cutoffcvCV -> cutoff freq.
rescvCV -> resonance.

outputs

audioaudioAudio in.

params

cutoffHz20..20000(default 1000)
resonancelinear0..0.99(default 0.1)
modediscrete0..2(default 0)
cutoff_cv_amtlinear-1..1(default 1)
res_cv_amtlinear-1..1(default 1)
source · filter.ts
qbrt filters

Stereo state-variable filter with vactrol-style ping input.

qbrtLaudioRaudiopinggatecutoffcvresonancecvmodecvpingDecaycvLaudioRaudioaudiocvgatepitch

inputs

LaudioStereo input L.
RaudioStereo input R.
pinggateGate -> click excitation.
cutoffcvCV -> cutoff.
resonancecvCV -> resonance.
modecvCV -> filter mode.
pingDecaycvCV -> ping envelope decay.

outputs

LaudioStereo input L.
RaudioStereo input R.

params

cutoffHz20..20000(default 1000)
resonancelinear0..0.99(default 0.7)
modelinear0..1(default 0)
pingDecays0.005..0.5(default 0.15)
source · qbrt.ts

effects

backdraft effects

BACKDRAFT is a video feedback generator. It builds a "source" image by crossfading two video inputs (IN A / IN B) with MIX, then composites that against a processed copy of its OWN previous output, read from an internal ring of past frames so there is no live GL feedback loop (downstream sees frame N while the tap reads N-1..N-60). The fed-back frame is delayed (DELAY, 0-1000ms or a clock pulse), colour-processed (per-channel R/G/B gain, then LUMA brightness, then CHROMA saturation), scaled per-pixel by two key masks (KEY+ lightens / KEY- darkens the effect), and geometrically warped a little each pass (ZOOM/ROTATE/OFF X/OFF Y) so the transform COMPOUNDS into tunnels, spirals, and directional trails. Two MIRROR buttons fold the whole composited frame into a kaleidoscope. A SHAPE button cuts the frame to a geometric mask (square = full frame, then circle / pentagon / triangle / octagon), and a PURE GEO button picks the masking SPACE: ON masks the FINAL OUTPUT in screen space (a fixed shape that cuts everything outside it at all zooms), OFF masks the SOURCE in the zoomed feedback space so the shape scales with ZOOM and its content spills out through the feedback tunnel (zoom-in pushes it toward the corners, zoom-out shrinks it). As FEEDBACK approaches its max (and a spatial transform is active) the additive trail-accumulator ramps into a pure recursive hall of mirrors. A FLICKER control (OFF / 6 / 24 / 50 / 60 / 120 Hz) models the display's pulsed emission as the virtual camera actually captures it, and then models what the CAMERA does to it: the emission rate beats against the camera's 60 fps sampling, so the per-frame loop gain oscillates around unity instead of being constant, and light can build up over several frames and then fade away rather than pinning at white — with a rolling-shutter band crawling down the frame at the beat rate. The captured light then passes through the sensor's multi-frame charge storage (a low-pass on the BEAT, so fast beats become soft shimmer while slow ones keep their full swing) and its saturating shoulder (so the modulation stops acting where the image is already hot and reads as contour shimmer rather than a full-field flash). That is what makes the fast positions breathe instead of strobe. Usage: patch a camera or generator into IN A, raise FEEDBACK toward ~1 and nudge ZOOM off 1.0 (with a little ROTATE) for the classic infinite-tunnel look; add OFF X/Y for smear, PIXELATE for blocky lo-fi, a SHAPE for a geometric vignette, and clock DELAY CLK for rhythmic echo. Output is the OUT video jack. The card carries NO in-rack picture. It used to show a 320×240 display, and that display was the single biggest consumer of the card's width and height; taking it out bought the module a narrower rack tier and taller faders, which is the better trade for a panel with this many controls. Feedback is still steered by watching it, so the output is one click away rather than always-on: the ⛶ OUTPUT button opens Full Frame (the card itself becomes a video panel in the rack), Full Screen, and Present-on-another-display, all of which grow the SAME surface — the button is now the only entry point, since there is no picture to right-click. For an arbitrarily-sized monitor, patch OUT into VIDEO OUT. The controls sit in two rows. Down the left of the first row are the discrete switches — MIRROR X / MIRROR Y, SHAPE and PURE GEO — with TV MODE, its fill/band readout and the OUTPUT button to their right and the six-position FLICKER switch beneath them; beside and below them run the labelled fader banks: LOOP (Mix/FB/Delay), COLOUR (Luma/Chroma/R/G/B), KEY (Lighten/Darken), GEOMETRY (Zoom/Rotate/Off X/Off Y/Pixelate), TV SCREEN (Room/Border/Phosphor/Drive — BORDER is the bezel, i.e. the screen frame's thickness) and VIRTUAL CAMERA, whose two 2-D pads steer the camera's TILT and POSITION with a DIST fader beside them. A control that does nothing in the current mode is DIMMED rather than hidden or disabled, so it stays draggable, resettable and MIDI-learnable and the card never changes height with the mode: the TV SCREEN bank dims while TV MODE is OFF (its title becomes a button that turns TV MODE on), and PURE GEO dims in PURE TV / CRITICAL, where SHAPE means only the screen's outline.

backdraftin_avideoin_bvideolightenvideodarkenvideomixcvfeedbackcvdelaycvdelay_clockcvlumacvchromacvrcvgcvbcvlighten_cvcvdarken_cvcvpixelatecvzoomcvrotatecvoffsetxcvoffsetycvmirror_x_gatecvmirror_y_gatecvshape_gatecvpure_geo_gatecvtv_gatecvroomcvphosphorcvdrivecvcam_tilt_xcvcam_tilt_ycvcam_pos_xcvcam_pos_ycvcam_distcvpaniccvoutvideoaudiocvgatepitch

inputs

in_avideovideo
in_bvideovideo
lightenvideovideo
darkenvideovideo
mixcvCV -> mix param.
feedbackcvCV -> feedback param.
delaycvCV -> delay param.
delay_clockcvCV -> delayClock param.
lumacvCV -> luma param.
chromacvCV -> chroma param.
rcvCV -> r param.
gcvCV -> g param.
bcvCV -> b param.
lighten_cvcvCV -> lighten param.
darken_cvcvCV -> darken param.
pixelatecvCV -> pixelate param.
zoomcvCV -> zoom param.
rotatecvCV -> rotate param.
offsetxcvCV -> offsetX param.
offsetycvCV -> offsetY param.
mirror_x_gatecvCV -> mirrorXGate param.
mirror_y_gatecvCV -> mirrorYGate param.
shape_gatecvCV -> shapeGate param.
pure_geo_gatecvCV -> pureGeoGate param.
tv_gatecvCV -> tvGate param.
roomcvCV -> room param.
phosphorcvCV -> phosphor param.
drivecvCV -> drive param.
cam_tilt_xcvCV -> camTiltX param.
cam_tilt_ycvCV -> camTiltY param.
cam_pos_xcvCV -> camPosX param.
cam_pos_ycvCV -> camPosY param.
cam_distcvCV -> camDist param.
paniccvCV -> panicGate param.

outputs

outvideovideo

params

mixlinear0..1
feedbacklinear0..?
delaylinear0..?
lumalinear-1..2
chromalinear-1..2
rlinear-1..2
glinear-1..2
blinear-1..2
lightenlinear0..1
darkenlinear0..1
pixelatelinear0..1
zoomlinear?..?
rotatelinear?..?
offsetXlinear?..?
offsetYlinear?..?
delayClocklinear0..1
mirrorXdiscrete0..1
mirrorYdiscrete0..1
mirrorXGatelinear0..1
mirrorYGatelinear0..1
shapediscrete0..?
pureGeodiscrete0..1
shapeGatelinear0..1
pureGeoGatelinear0..1
flickerdiscrete0..?
tvModediscrete0..?
tvGatelinear0..1
roomlinear0..1
bezellinear0..1
phosphorlinear0..1
drivelinear0..1
camTiltXlinear?..?
camTiltYlinear?..?
camPosXlinear?..?
camPosYlinear?..?
camDistlinear0..1
freezelinear0..1
panicGatelinear0..1
source · backdraft.ts
cellshade effects

Real cel-shader (toon) video PROCESSOR — the canonical live-video cel pipeline (Winnemöller's Real-Time Video Abstraction) as a 4-pass chain. Takes a video input and emits a cel-shaded version: (1) an edge-preserving SEPARABLE BILATERAL smoothing pass (SMOOTH, 0..1, default 0.35 — 0 is a true bypass: the passes are skipped entirely) flattens low-contrast texture/noise into the large flat regions that read as hand-painted while keeping strong contours crisp; (2) a SOFT LUMINANCE QUANTIZATION pass collapses the smoothed image's Rec. 601 luma into N flat tonal bands — BANDS is a 5-step DISCRETE knob mapping to {2, 3, 4 (default), 6, 8} bands (the param id stays the legacy `bits`, same 0..4 index range, so saved patches + CV cables load with zero migration) — with a smoothstep transition whose half-width SOFT (0..1, default 0.25) widens from hard-edged bands to a near-continuous ramp; reconstruction is the additive luma shift out = clamp(rgb + (Yq − Y)) (YCbCr Y-replacement), so CHROMA IS NEVER QUANTIZED — hue and saturation ride through and each band is a flat tonal step of consistent colour (a yellow stays yellow, a skin tone stays warm); (3) a Sobel INK pass (the exact EDGES algorithm — same Rec. 601 luma, normalisation, THRESHOLD gate and THICKNESS dilation — measured on the SMOOTHED image so sensor noise never inks) composites the salient contours as dark outline strokes scaled by INK (0..1, default 1: 0 = no lines, 1 = solid black). STATELESS per frame — the look tracks the live source with no feedback. THRESHOLD (0..1, default 0.2) gates which contours get inked; THICKNESS (1..8 px, default 2) dilates the strokes wider. All six params have matching CV inputs (port id == param id; BANDS uses a discrete cvScale so CV snaps to the 5 steps). IN takes RGB; OUT is video — patch a source (CAMERA / VIDEOBOX / SHAPES / a generator) → IN, OUT → OUTPUT or a video mixer; drop BANDS + raise INK for bold comic cels, raise SMOOTH for painterly abstraction, use SOFT to trade crisp band edges against shimmer-free gradients on live video. (The old 8/16-bit per-channel RGB retro posterize modes were dropped in the rebuild — that look is posterization, not cel, and belongs to the POSTERBOX module.)

cellshadeinvideothresholdcvthicknesscvbitscvsoftnesscvsmoothcvinkcvoutvideoaudiocvgatepitch

inputs

invideovideo
thresholdcvCV -> threshold param.
thicknesscvCV -> thickness param.
bitscvCV -> bits param.
softnesscvCV -> softness param.
smoothcvCV -> smooth param.
inkcvCV -> ink param.

outputs

outvideovideo

params

thresholdlinear0..1
thicknesspx1..?
bitsdiscrete0..?
softnesslinear0..1
smoothlinear0..1
inklinear0..1
source · cellshade.ts

Destructive multi-head stereo delay. Pitch-shifted feedback with decay.

charlotte's echosLaudioRaudiodelaycvLaudioRaudioaudiocvgatepitch

inputs

LaudioStereo L in / out.
RaudioStereo R in / out.
delaycvCV -> delay time.

outputs

LaudioStereo L in / out.
RaudioStereo R in / out.
source · charlottes-echos.ts
chroma effects

CHROMA is a single-input hue-shifter / colorizer (not a keyer — use CHROMAKEY to composite a foreground over a background). For every pixel of the incoming video it converts RGB to HSV, rotates the hue by the Hue control (in degrees, wrapped with fract() so it cycles cleanly around the color wheel including negative shifts), multiplies the saturation by the Sat control (0 desaturates to grayscale, 1 leaves color untouched, above 1 intensifies toward fully-saturated color — the result is clamped at maximum saturation so it can't exceed it), converts back to RGB, then lerps the result toward the tint color (tintR/tintG/tintB) by the Mix amount. With Mix at 0 the tint is bypassed and you get a pure hue/saturation pass; at 1 every pixel becomes the flat tint color, with values in between producing a duotone-style wash that biases the image toward the chosen color. Use it to recolor a clip, sweep a video through the spectrum (patch an LFO into hue), drain it to black-and-white, or apply a colored grade. With no input connected the output is opaque black.

chromainvideohuecvsaturationcvtintRcvtintGcvtintBcvtintMixcvoutvideoaudiocvgatepitch

inputs

invideovideo
huecvCV -> hue param.
saturationcvCV -> saturation param.
tintRcvCV -> tintR param.
tintGcvCV -> tintG param.
tintBcvCV -> tintB param.
tintMixcvCV -> tintMix param.

outputs

outvideovideo

params

huelinear-180..180
saturationlinear0..2
tintRlinear0..1
tintGlinear0..1
tintBlinear0..1
tintMixlinear0..1
source · chroma.ts
chromakey effects

chromakey is a two-input green-screen compositor: it takes a foreground video (the layer shot against a key colour) and a background video, and replaces every foreground pixel that is chromatically close to the chosen key colour with the matching background pixel. Per pixel it measures the DISTANCE IN THE CHROMA PLANE (full-swing Rec. 601 Cb/Cr) between the pixel and the key colour, normalized by the key's own chroma strength — the industry-standard keying metric — and builds an alpha via smoothstep over the thr/soft window (alpha 0 = show background, alpha 1 = keep foreground). A neutral gray always sits at exactly distance 1.0 from a saturated key, so shadows, highlights and low-saturation subject pixels survive the key without any special gating. Spill suppression then limits the key colour's dominant channel on the KEPT foreground (for a green key: green is pulled down toward max(red, blue)), removing green contamination from the subject itself — not just from the matte edge. Pick the key colour with the swatch (defaults to pure green), then tune thr: the default 0.5 keys real-world screen variation (shading, off-tint) while keeping subjects; lower it toward 0.15 to key only near-pure key pixels, raise soft to feather the matte edge, and raise spill to remove key-colour fringing from the subject. If no foreground is patched it just passes the background through. Note: an achromatic (black/white/gray) key colour has no chroma to measure against, so ALL neutral pixels key out together regardless of brightness — for keying off a black or white backdrop use lumakey instead.

chromakeyfgvideobgvideokeyRcvkeyGcvkeyBcvthresholdcvsoftnesscvspillSuppresscvoutvideoaudiocvgatepitch

inputs

fgvideovideo
bgvideovideo
keyRcvCV -> keyR param.
keyGcvCV -> keyG param.
keyBcvCV -> keyB param.
thresholdcvCV -> threshold param.
softnesscvCV -> softness param.
spillSuppresscvCV -> spillSuppress param.

outputs

outvideovideo

params

keyRlinear0..1
keyGlinear0..1
keyBlinear0..1
thresholdlinear0..1
softnesslinear0..0.5
spillSuppresslinear0..1
source · chromakey.ts
clouds effects

Granular texture processor (Mutable Instruments Clouds archetype, Émilie Gillet, 2014, MIT-licensed) — 2-second stereo ring buffer + overlap-added grain cloud (up to 24 grains) + latched FREEZE. Six macros (Position / Size / Pitch / Density / Texture / Blend) with V/oct grain-pitch tracking on the pitch input. v1 ships GRANULAR mode only; STRETCH / LOOPING-DELAY / SPECTRAL modes deferred to follow-up.

cloudsin_laudioin_raudiopitchpitchfreeze_gategateposition_cvcvsize_cvcvpitch_cvcvdensity_cvcvtexture_cvcvblend_cvcvout_laudioout_raudioaudiocvgatepitch

inputs

in_laudioAudio signal.
in_raudioAudio signal.
pitchpitchV/oct pitch CV.
freeze_gategateGate signal (rising/falling edge).
position_cvcvCV -> position param.
size_cvcvCV -> size param.
pitch_cvcvCV -> pitch param.
density_cvcvCV -> density param.
texture_cvcvCV -> texture param.
blend_cvcvCV -> blend param.

outputs

out_laudioAudio signal.
out_raudioAudio signal.

params

positionlinear0..1(default 0.5)
sizelinear0..1(default 0.5)
pitchst-24..24(default 0)
densitylinear0..1(default 0.5)
texturelinear0..1(default 0.5)
blendlinear0..1(default 0.5)
freezediscrete0..1(default 0)
source · clouds.ts
cloudseed effects

Exact algorithm port of Ghost Note Audio's CloudSeed reverb (MIT-licensed, github.com/GhostNoteAudio/CloudSeedCore). Stereo input cross-mixes then per-channel passes through: optional 1-pole HP + LP pre-EQ → modulated pre-delay → multitap early-reflection field (up to 256 taps, seed-deterministic) → AllpassDiffuser (up to 12 stages) → 12 parallel late-field DelayLine voices, each with optional in-loop AllpassDiffuser + LowShelf + HighShelf + LP, with T60-targeted feedback that produces a precise decay-seconds tail. Cross-seed control divides the L/R seeded delay layouts for stereo decorrelation. 45 parameters total — 7 macros (DRY / EARLY / LATE faders, INPUT MIX, LOW CUT, HIGH CUT, CROSS SEED) are exposed as AudioParams for CV summing; 38 toggle/integer/seed/modulation parameters live on the worklet's message port. Bundled v1 preset bank: DIVINE INSPIRATION (DarkPlate from Programs.h verbatim), SHORT ROOM, BRIGHT HALL, INFINITE PAD. Card footer cycles through the preset bank with click-numbered slots, prev/next arrows, and a live DECAY readout that reflects LateLineDecay's computed RT60.

cloudseedin_laudioin_raudiodry_cvcvearly_cvcvlate_cvcvinput_mix_cvcvlow_cut_cvcvhigh_cut_cvcvcross_seed_cvcvout_laudioout_raudioaudiocvgatepitch

inputs

in_laudioAudio signal.
in_raudioAudio signal.
dry_cvcvCV -> dry_out param.
early_cvcvCV -> early_out param.
late_cvcvCV -> late_out param.
input_mix_cvcvCV -> input_mix param.
low_cut_cvcvCV -> low_cut param.
high_cut_cvcvCV -> high_cut param.
cross_seed_cvcvCV -> cross_seed param.

outputs

out_laudioAudio signal.
out_raudioAudio signal.

params

dry_outlinear0..1(default 0.87)
early_outlinear0..1(default 0)
late_outlinear0..1(default 0.66)
input_mixlinear0..1(default 0.23)
low_cutlinear0..1(default 0.64)
high_cutlinear0..1(default 0.29)
cross_seedlinear0..1(default 0)
preset_indexdiscrete0..?(default 0)
source · cloudseed.ts

Analog BBD/tape-style stereo delay — a clean-room, OWN-CODE engine (the replacement for the retired Cocoa Delay; its own DSP, no GPL lineage). A 10-second stereo delay line read at a fractional position with 4-point Catmull-Rom cubic interpolation; the read time is modulated two ways: a WOW LFO (AMOUNT × sin at FREQUENCY) and a slow random FLUTTER drift walk (AMOUNT × random, SPEED) on a fixed-seed PRNG (deterministic). Feedback is bipolar (−1..+1), clamped just below unity for stability, with a STEREO offset that skews the L/R read times apart and a PAN with three modes (STATIC rotation, PING-PONG feedback cross, CIRCULAR rotating the wet image). DUCKING sidechains the wet level by an envelope follower on the dry input (AMOUNT, ATTACK, RELEASE). A multi-mode TONE filter (1/2/4-pole cascade or state-variable) low-cuts + high-cuts inside the feedback path, and a stateful tanh DRIVE saturator (GAIN / MIX / FILTER, run 1–16 ITERATIONS) dirties the loop. DRY + WET set the output mix. The read pointer eases toward its target so TIME changes glide like a tape motor. TEMPO SYNC locks the delay time to a musical division (1/4, 1/8, dotted, triplet…) of a clock period measured from pulses on the CLOCK gate input; the CLK SRC dropdown labels whether that clock is the rack SYSTEM clock (TIMELORDE) or external MIDI (MIDICLOCK). When sync is Off the TIME knob is free-running seconds. CV inputs cover the musical params: time, feedback, mix, drive, WOW amount, FLUTTER, pan, ducking.

cofefve delayinLaudioinRaudioclockgatetime_cvcvfeedback_cvcvmix_cvcvdrive_cvcvlfo_cvcvdrift_cvcvpan_cvcvduck_cvcvoutLaudiooutRaudioaudiocvgatepitch

inputs

inLaudioAudio signal.
inRaudioAudio signal.
clockgateGate signal (rising/falling edge).
time_cvcvCV -> delayTime param.
feedback_cvcvCV -> feedback param.
mix_cvcvCV -> wetVolume param.
drive_cvcvCV -> driveGain param.
lfo_cvcvCV -> lfoAmount param.
drift_cvcvCV -> driftAmount param.
pan_cvcvCV -> pan param.
duck_cvcvCV -> duckAmount param.

outputs

outLaudioAudio signal.
outRaudioAudio signal.

params

delayTimes0.001..2(default 0.2)
tempoSyncdiscrete0..19(default 0)
clockSourcediscrete0..1(default 0)
lfoAmountlinear0..0.5(default 0)
lfoFrequencyhz0.1..10(default 2)
driftAmountlinear0..0.05(default 0.001)
driftSpeedlog0.1..10(default 1)
feedbacklinear-1..1(default 0.5)
stereoOffsetlinear-0.5..0.5(default 0)
panlinear?..?(default 0)
panModediscrete0..2(default 0)
duckAmountlinear0..10(default 0)
duckAttacklog0.1..100(default 10)
duckReleaselog0.1..100(default 10)
filterModediscrete0..3(default 0)
lowCutlinear0.01..1(default 0.75)
highCutlinear0.001..0.99(default 0.001)
driveGainlinear0..10(default 0.1)
driveMixlinear0..1(default 1)
driveCutofflinear0.01..1(default 1)
driveIterationsdiscrete1..16(default 1)
dryVolumelinear0..2(default 1)
wetVolumelinear0..2(default 0.5)
source · cofefve.ts
colorizer effects

colorizer tints a mono (single-channel) video signal into a solid color. Each incoming pixel is reduced to a single brightness value by averaging its R, G and B channels, and that brightness then scales a tint color you set with the R/G/B faders: the output pixel is (mono x R, mono x G, mono x B). The result reads as a one-color image whose intensity follows the input's luma, so dark areas stay black and bright areas hit the full tint. Feed it a luma key, an oscilloscope-style mono shape or any video, then dial the three faders to recolor it; with no input connected the output is solid black.

colorizerinmono-videotintRcvtintGcvtintBcvoutvideoaudiocvgatepitch

inputs

inmono-videomono-video
tintRcvCV -> tintR param.
tintGcvCV -> tintG param.
tintBcvCV -> tintB param.

outputs

outvideovideo

params

tintRlinear0..1
tintGlinear0..1
tintBlinear0..1
source · colorizer.ts

COLOUR OF MAGIC — a multi-colorspace video PROCESSOR. One video IN runs through FIVE parallel colorspace blocks — RGB, YDbDr (the SECAM luma+chroma broadcast space), HSV-or-HSL, YIQ (the NTSC composite space, its orange↔cyan flesh-tone I axis + green↔magenta Q axis), and YCbCr BT.601 STUDIO-SWING (the broadcast-legal 16–235 / 16–240 window whose ~1.16× decode expansion CRUSHES super-black/white like a proc-amp) — each block encoding the picture into that space, adjusting each component, then decoding back to RGB. Every block has, per channel: a BIAS knob (additive offset, identity at 0) that also sums CV patched into its cv input; a MONO OVERRIDE input that REPLACES that channel with an incoming grayscale/video stream (bias still adds on top, so a patched key can still be offset); and an OVER/CLAMP toggle — CLAMP clips out-of-range to 0..1 (a legal clip) while OVER wraps it around via fract() (the LZX chroma-wrap look where over-driven values fold back through the spectrum). Bipolar chroma rides a 0.5 pedestal (YDbDr Db/Dr, YIQ I/Q) or the authentic 128/255 = 0.502 pedestal (studio-swing Cb/Cr); HUE always wraps regardless of its toggle (which is advisory). The third block switches HSV↔HSL. TWENTY-TWO outputs run in parallel: pass (the untouched source); rgb / ydbdr / hsvhsl / yiq / ycc (each block colorized); and per-block grayscale channel taps — r / g / b / luma (RGB), ydb_y/db/dr (YDbDr), hsv_h/s/v (HSV·HSL), yiq_y/i/q (YIQ, its mono I tap a ready-made warmth/skin key), ycc_y/cb/cr (studio-swing). The RGB block also has a palette REPLACE mode: three colour-picker swatches remap the adjusted R/G/B channels to chosen output colours (a duotone/tritone recolour) before the rgb out — picking a swatch auto-enables REPLACE and the swatches default to a non-identity teal/orange/violet so it recolours immediately. Only the outputs you PATCH downstream (plus the one you PREVIEW) are rendered each frame, so the many taps stay cheap. With nothing patched all outputs are opaque black. All colorspace math is a 1:1 mirror of the pure, unit-tested $lib/video/colourofmagic-colorspace core. The card has a live preview (with a 22-way output selector), the five block columns of knobs + OVER/CLAMP pills, the HSV/HSL toggle, and the palette REPLACE swatches; all CV + mono-override jacks + the 22 outputs live in the sectioned yellow drill-down PATCH PANEL (IN / RGB / YDbDr / HSV-HSL / YIQ / YCbCr / OUT, no raw side jacks).

colour of magicinvideorgb_r_cvcvrgb_r_inmono-videorgb_g_cvcvrgb_g_inmono-videorgb_b_cvcvrgb_b_inmono-videoydb_y_cvcvydb_y_inmono-videoydb_db_cvcvydb_db_inmono-videoydb_dr_cvcvydb_dr_inmono-videohsv_h_cvcvhsv_h_inmono-videohsv_s_cvcvhsv_s_inmono-videohsv_v_cvcvhsv_v_inmono-videoyiq_y_cvcvyiq_y_inmono-videoyiq_i_cvcvyiq_i_inmono-videoyiq_q_cvcvyiq_q_inmono-videoycc_y_cvcvycc_y_inmono-videoycc_cb_cvcvycc_cb_inmono-videoycc_cr_cvcvycc_cr_inmono-videopassvideorgbvideoydbdrvideohsvhslvideormono-videogmono-videobmono-videolumamono-videoydb_ymono-videoydb_dbmono-videoydb_drmono-videohsv_hmono-videohsv_smono-videohsv_vmono-videoyiqvideoyiq_ymono-videoyiq_imono-videoyiq_qmono-videoyccvideoycc_ymono-videoycc_cbmono-videoycc_crmono-videoaudiocvgatepitch

inputs

invideovideo
rgb_r_cvcvCV -> bias_r param.
rgb_r_inmono-videomono-video
rgb_g_cvcvCV -> bias_g param.
rgb_g_inmono-videomono-video
rgb_b_cvcvCV -> bias_b param.
rgb_b_inmono-videomono-video
ydb_y_cvcvCV -> bias_y param.
ydb_y_inmono-videomono-video
ydb_db_cvcvCV -> bias_db param.
ydb_db_inmono-videomono-video
ydb_dr_cvcvCV -> bias_dr param.
ydb_dr_inmono-videomono-video
hsv_h_cvcvCV -> bias_h param.
hsv_h_inmono-videomono-video
hsv_s_cvcvCV -> bias_s param.
hsv_s_inmono-videomono-video
hsv_v_cvcvCV -> bias_v param.
hsv_v_inmono-videomono-video
yiq_y_cvcvCV -> bias_yiq_y param.
yiq_y_inmono-videomono-video
yiq_i_cvcvCV -> bias_yiq_i param.
yiq_i_inmono-videomono-video
yiq_q_cvcvCV -> bias_yiq_q param.
yiq_q_inmono-videomono-video
ycc_y_cvcvCV -> bias_ycc_y param.
ycc_y_inmono-videomono-video
ycc_cb_cvcvCV -> bias_ycc_cb param.
ycc_cb_inmono-videomono-video
ycc_cr_cvcvCV -> bias_ycc_cr param.
ycc_cr_inmono-videomono-video

outputs

passvideovideo
rgbvideovideo
ydbdrvideovideo
hsvhslvideovideo
rmono-videomono-video
gmono-videomono-video
bmono-videomono-video
lumamono-videomono-video
ydb_ymono-videomono-video
ydb_dbmono-videomono-video
ydb_drmono-videomono-video
hsv_hmono-videomono-video
hsv_smono-videomono-video
hsv_vmono-videomono-video
yiqvideovideo
yiq_ymono-videomono-video
yiq_imono-videomono-video
yiq_qmono-videomono-video
yccvideovideo
ycc_ymono-videomono-video
ycc_cbmono-videomono-video
ycc_crmono-videomono-video

params

bias_rlinear-1..1
bias_glinear-1..1
bias_blinear-1..1
bias_ylinear-1..1
bias_dblinear-1..1
bias_drlinear-1..1
bias_hdeg-180..180
bias_slinear-1..1
bias_vlinear-1..1
bias_yiq_ylinear-1..1
bias_yiq_ilinear-1..1
bias_yiq_qlinear-1..1
bias_ycc_ylinear-1..1
bias_ycc_cblinear-1..1
bias_ycc_crlinear-1..1
over_rdiscrete0..1
over_gdiscrete0..1
over_bdiscrete0..1
over_ydiscrete0..1
over_dbdiscrete0..1
over_drdiscrete0..1
over_sdiscrete0..1
over_vdiscrete0..1
over_hdiscrete0..1
over_yiq_ydiscrete0..1
over_yiq_idiscrete0..1
over_yiq_qdiscrete0..1
over_ycc_ydiscrete0..1
over_ycc_cbdiscrete0..1
over_ycc_crdiscrete0..1
mode_hsldiscrete0..1
replacediscrete0..1
pal_rdiscrete0..0
pal_gdiscrete0..0
pal_bdiscrete0..0
previewdiscrete0..21
freezediscrete0..1
source · colourofmagic.ts
delay effects

The primitive single-tap echo — one MONO audio jack in, one out, and the canonical time / feedback / mix trio, with no colour of its own. Built on Web Audio's native DelayNode plus a feedback gain loop (input → delay → feedback → output, crossfaded against dry), so it is the cheapest delay in the catalogue to instantiate — no worklet, no DSP thread. TIME ranges log from 1 ms (comb/flange) through slapback to 2 s (ambient washes); FEEDBACK is linear 0–0.95, hard-ceilinged below self-oscillation and deliberately NOT CV-able so the clamp is absolute; MIX is an equal-power dry/wet crossfade. The one CV jack is TIME, and it is audio-rate and unsmoothed: because the delay line reads at a fractional position, modulating it VARISPEEDS the buffer (the echoes Doppler-shift in pitch while the time moves — measured at ~498 Hz for a 1 kHz sine under a +0.5 s/s ramp), which is what makes it a chorus/flanger at small depths and a tape pitch-dive at large ones. No tempo sync, no clock input, no in-loop filtering or saturation, no stereo — COFEFVE is the full tape/BBD machine with all of those, CHARLOTTE'S ECHOS the destructive multi-head shimmer.

delayaudioaudiotimecvaudioaudioaudiocvgatepitch

inputs

audioaudioAudio signal.
timecvCV -> time param.

outputs

audioaudioAudio signal.

params

times0.001..?(default 0.25)
feedbacklinear0..?(default 0.4)
mixlinear0..1(default 0.35)
source · delay.ts
destroy effects

Bitcrusher + decimator distortion.

destroyaudioaudiodecimatecvbitscvwetcvaudioaudioaudiocvgatepitch

inputs

audioaudioAudio in / out.
decimatecvCV -> decimation factor.
bitscvCV -> bit depth.
wetcvCV -> wet/dry mix.

outputs

audioaudioAudio in / out.

params

decimatelinear1..64(default 1)
bitslinear1..16(default 16)
wetlinear0..1(default 1)
source · destroy.ts
destructor effects

DESTRUCTOR is a single-pass glitch/mangle effect that runs RGB video in and out. The fragment shader stacks three classic digital-decay artifacts: chromatic aberration (the red channel is sampled slightly left and the blue channel slightly right while green stays put, smearing color along the horizontal axis), scanline disruption (alternating rows of a 240-band horizontal grid are darkened), and posterization (each channel is quantized to a discrete number of levels, crushing smooth gradients into hard color steps). The master Mangle amount scales the chromatic aberration and scanline darkening only — posterization is applied independently from the Posterize control and is NOT affected by Mangle. With no input connected the module outputs solid black. Patch it after a source for a CRT/VHS-style decay, or sweep Mangle with an LFO for a pulsing shift/scanline glitch over a steady posterized base.

destructorinvideomanglecvoutvideoaudiocvgatepitch

inputs

invideovideo
manglecvCV -> mangle param.

outputs

outvideovideo

params

shiftlinear0..1
scanlinelinear0..1
posterizelinear0..1
manglelinear0..1
source · destructor.ts
edges effects

Per-frame Sobel edge-detection video PROCESSOR. Takes a video input, runs a 3×3 Sobel operator on its per-pixel Rec. 601 LUMINANCE (gradient magnitude = sqrt(Gx²+Gy²), normalised so a unit luma step reads ~1.0), and emits a MONO-VIDEO frame: white where an edge was detected, black everywhere else. STATELESS per frame — the detected edges move/transform live with the source (no feedback, no history). THRESHOLD (0..1, default 0.2) gates which gradients count as edges (below → black; raise it to keep only the strongest contours, lower it to let faint gradients through). THICKNESS (1..8 px, default 2) DILATES the detected edge mask (morphological MAX over a square neighbourhood of radius thickness-1 texels) so a 1px edge renders up to `thickness` px wide; thickness=1 is the raw edge. IN takes RGB; OUT is mono-video (white edges on black) — patch it into OUTPUT, a video mixer, COLORIZER (mono→video upcast), or back into another video module as a key mask. THRESHOLD + THICKNESS each have a matching CV input (port id == param id). Pairs well with a moving source (CAMERA / VIDEOBOX / SHAPES) for live rotoscoped outlines.

edgesinvideothresholdcvthicknesscvoutmono-videoaudiocvgatepitch

inputs

invideovideo
thresholdcvCV -> threshold param.
thicknesscvCV -> thickness param.

outputs

outmono-videomono-video

params

thresholdlinear0..1
thicknesspx1..?
source · edges.ts
feedback effects

Analog-video-style feedback loop, the on-screen equivalent of pointing a camera at its own monitor. Each frame it re-samples its OWN previous output from a ping-pong framebuffer through a small affine warp — rotate and scale the UV about the canvas center, plus a tiny XY offset — multiplies that warped tap by Decay, then adds the fresh input (weighted by 1 minus the clamped decay) to form a recursive accumulator. That accumulator is cross-faded against the dry input by Wet and clamped to [0,1] so destructive Decay over 1.0 saturates white instead of NaN-ing. With Zoom slightly above 1 and a touch of Rotate you get the classic infinite spiraling "tunnel"; the prior frame is sampled black outside the canvas (no edge smear) so trails decay into darkness rather than melting along the borders. Patch a camera or any video source into IN, feed OUT back to a monitor, and modulate the warp via the CV inputs for evolving, self-oscillating imagery.

feedbackinvideowetcvdecaycvzoomcvrotatecvoffsetXcvoffsetYcvoutvideoaudiocvgatepitch

inputs

invideovideo
wetcvCV -> wet param.
decaycvCV -> decay param.
zoomcvCV -> zoom param.
rotatecvCV -> rotate param.
offsetXcvCV -> offsetX param.
offsetYcvCV -> offsetY param.

outputs

outvideovideo

params

wetlinear0..1
decaylinear0..2
zoomlinear0.9..1.1
rotatelinear-3.14159..3.14159
offsetXlinear-1..1
offsetYlinear-1..1
source · feedback.ts
frametable effects

FRAMETABLE — a video WAVETABLE oscillator. It continuously records the last 60 rendered input frames into a GPU frame ring (a TEXTURE_2D_ARRAY, one layer per frame) and treats that 60-frame history like the single-cycle waves of a wavetable synth: MORPH scans a centre point through the table and SPREAD sets how wide a window around that centre each output pixel may draw from. For EVERY output pixel the shader draws exactly ONE source frame — a whole-pixel dither/mosaic, NEVER an alpha-average across frames — chosen probabilistically from a bell distribution over the window (centre frame most likely, periphery least). The frame index is picked in O(1) by an analytic inverse-CDF (one sqrt, one branch, one texture-array fetch — never a 60-frame loop). The per-pixel choice is fixed in SCREEN space by a static per-pixel threshold with NO time term, so a STILL input yields a stable image (no TV-static shimmer) even while the ring keeps refreshing, while MOVING content becomes a coherent, morph-scannable time-smear mosaic that scanning MORPH slides through like a soft crossfade. SPREAD 1 collapses to a single frame (a delta — crisp playback of one moment); wider SPREAD blends more of the history into the bell, centre frame still most likely. SHAPE morphs the bell from triangular (default, compact) to gaussian (smooth). SHIMMER (default 0 = fully static) animates the threshold along a golden-ratio sequence for a gentle living grain on moving content while the time-averaged distribution stays exactly the target bell. FREEZE (a toggle button, plus a freeze gate that holds the ring frozen while the gate is held high) stops the ring from advancing so you can scrub a held 60-frame window with MORPH/SPREAD; SAVE (a momentary button, also a rising edge on the SAVE trigger) snapshots the current 60-frame ring into an in-GPU slot for later recall (and to feed a future video Cube — the snapshot + live ring are readable through the handle). Beyond that in-GPU slot, FRAMETABLE saves + loads REAL FILES, mirroring the wavetable file workflow: SAVE FILE writes the whole 60-frame ring to a lossless .frametable.png sprite-sheet atlas (a fixed 10×6 = 60-tile contact sheet, no video codec) via the save-file picker (with a download fallback); LOAD reads a .frametable.png back into the ring, freezing it so the loaded table can be morphed/scanned. The multi-megabyte frame bytes persist PER-BROWSER in IndexedDB (never the Y.Doc — only a tiny file descriptor syncs), so a loaded/saved table survives a reload on the same machine. Rendered at half engine resolution (SwiftShader/CI budget); an unpatched input renders black. The selection math (triangular + gaussian inverse-CDF, ring wrap, head→layer mapping, freeze/save reducers) is a 1:1 CPU mirror unit-tested in $lib/video/frametable-core. All ports live on the yellow drill-down PATCH PANEL (no raw side jacks). Look-affecting new WebGL shader — held for owner visual preview.

frametablevideo_invideomorph_cvcvspread_cvcvshimmer_cvcvweightShape_cvcvwaveFreqX_cvcvwaveAmtX_cvcvwaveShapeX_cvcvwaveFreqY_cvcvwaveAmtY_cvcvwaveShapeY_cvcvfreeze_gategatesave_triggatechaos_gategatelive_gategatevideo_outvideoaudiocvgatepitch

inputs

video_invideovideo
morph_cvcvCV -> morph param.
spread_cvcvCV -> spread param.
shimmer_cvcvCV -> shimmer param.
weightShape_cvcvCV -> weightShape param.
waveFreqX_cvcvCV -> waveFreqX param.
waveAmtX_cvcvCV -> waveAmtX param.
waveShapeX_cvcvCV -> waveShapeX param.
waveFreqY_cvcvCV -> waveFreqY param.
waveAmtY_cvcvCV -> waveAmtY param.
waveShapeY_cvcvCV -> waveShapeY param.
freeze_gategateGate signal (rising/falling edge).
save_triggateGate signal (rising/falling edge).
chaos_gategateGate signal (rising/falling edge).
live_gategateGate signal (rising/falling edge).

outputs

video_outvideovideo

params

modediscrete0..2
livediscrete0..1
chaosdiscrete0..1
morphlinear0..1
spreadlinear1..60
shimmerlinear0..1
weightShapelinear0..1
freezediscrete0..1
waveFreqXlinear0..8
waveAmtXlinear0..1
waveShapeXlinear0..1
waveFreqYlinear0..8
waveAmtYlinear0..1
waveShapeYlinear0..1
liveGatelinear0..1
chaosGatelinear0..1
freezeGatelinear0..1
saveTrigdiscrete0..1
source · frametable.ts
freezeframe effects

FREEZEFRAME fuses two video effects in one card. First, a SAMPLE & HOLD "freeze": with nothing patched to GATE the source passes through live; patch a gate and the image FREEZES, and the GATE jack then honours both readings of the gate cable at once. Send a TRIGGER at it and each rising edge updates EXACTLY ONE frame, after which it is still again. Hold the gate HIGH (level >= 0.5) and you get that same one-frame update at the edge, and then — once the level has STOOD high for about 75 ms — continuous live updating for as long as it stays high. That 75 ms is deliberate and is the shortest honest answer available: the patch bridge does not stream the gate waveform to a video module, it re-reports the level roughly every 25 ms, so for the first tick or two a 5 ms trigger and a gate that has just opened are literally the same bytes. Anything held shorter than the window is therefore classified as a TRIGGER and updates exactly one frame — including a gate DERIVED from a trigger by GATEMAIDEN, whose default width is 50 ms, so inserting GATEMAIDEN into the path does not change the frame count. In practice a square LFO below roughly 6.6 Hz plays while open and stutter-freezes the instant it closes (at 1 Hz about 44 percent of frames update, at 4 Hz about 26 percent); faster than that knee each cycle contributes only its one edge frame and the module reads as a strobe, which is the frame-rate-independent reading anyway. Short pulses cannot be missed or double-counted — the rising edge is detected as the gate value arrives rather than sampled once per rendered frame, and the one-shot is a latch a single frame consumes. The first frame always captures so the buffer seeds with real content instead of black. Second, a PER-CHANNEL POSTERIZE: four QUANT knobs each reduce one channel's colour depth, mapping the sweep geometrically in log2 from 256 levels (full depth) at min, through 32 at midway, to 2 (on/off) at max — crank all four for a hard few-bit posterized look. The shader posterizes each channel with floor(c*levels)/(levels-1); the combined output also applies the QUANT-luma reduction as a hue-preserving luma ratio so that knob still shapes the main out. Third, PHOSPHOR DECAY: switch DECAY on and a held frame no longer just sits there — it fades exponentially to black over the DECAY TIME knob's 0.05 to 2 seconds, the way a CRT phosphor gives up once the beam stops refreshing it, and INVERT sends it to white instead. DECAY TIME reads as "gone by": at the time you dial in the frame has reached the target exactly and stays there, rather than the 37 percent a 1/e time constant would leave behind. It is only visible WHILE THE IMAGE IS FROZEN, which is not a limitation but what the effect IS — decay is the age of the held frame, so with GATE unpatched (live passthrough) or held open every frame is brand new and the switch legitimately does nothing. The fade is evaluated from elapsed TIME rather than accumulated per frame, so it takes the same real half-second whether the renderer is managing 8 frames a second or 240, and it is applied after the posterizer (a signal is quantized, then a display persists it) so it still fades smoothly even with all four QUANT knobs at max. Five outputs let you tap the recombined image, each isolated channel as a grey intensity image, or the Rec.601 luma. Usage hint: drive GATE from an LFO or clock to strobe/freeze a video feed, then dial the QUANT knobs for VHS/8-bit colour crushing; add DECAY for trailing strobe ghosts; fan the R/G/B/LUMA taps into separate processors for channel-split effects.

freezeframevideo_invideogate_ingatevideo_outvideor_outvideog_outvideob_outvideoluma_outvideoaudiocvgatepitch

inputs

video_invideovideo
gate_ingateGate signal (rising/falling edge).

outputs

video_outvideovideo
r_outvideovideo
g_outvideovideo
b_outvideovideo
luma_outvideovideo

params

quant_rlinear0..1
quant_glinear0..1
quant_blinear0..1
quant_lumalinear0..1
decaydiscrete0..1
decay_invertdiscrete0..1
decay_times?..?
gateLevellinear0..1(default 0)
source · freezeframe.ts

GRAINS OF VISION — a granular VIDEO synthesizer. It shatters the incoming picture into a swarm of tiny windowed patches (grains) sampled from source A at jittered positions AND jittered moments in time (from a short frame-history ring, so grains have a real TEMPORAL axis — the novel part of granular VIDEO), re-scatters them into a new frame, then runs that through a FEEDBACK block and a video REVERB block on ONE fixed linear chain (video -> granular engine -> feedback -> reverb -> out) — NOT a node graph. The grain engine is a single fullscreen pass that is O(1) per pixel regardless of density: the frame is a jittered grid of cells (DENSITY = cells across), each cell hosts one hashed grain, and every pixel gathers its 3x3 cell neighbourhood, window-weights each grain and normalises — so density changes grain SIZE, not the cost. Knobs map the audio-granular vocabulary onto the image: SIZE (window radius), WINDOW (hard chip -> soft gaussian), SPRAY (position scatter of the grain + source-read; 0 reconstructs the picture faithfully, rising clouds it into abstraction), RATE (how far back in the frame history grains read — the pitch/rate analog), T-SPRAY (temporal scatter for a shimmering time-smear), ORIENT (per-grain rotation). The FEEDBACK block mixes the transformed previous OUTPUT back in (FB amount / decay / per-pass zoom + rotate that compound into tunnels and spirals); FB amount 0 (or FB Dry) is a transparent dry passthrough. The REVERB block is a true VIDEO reverb — the image analogue of an FDN/Schroeder tail: a decaying, spatially-diffused temporal accumulator (rev = blur(feedbackImg + decay*prevRev)), so each bright grain blooms outward (Rev Size = room size, Rev Diffuse = tap scatter) and lingers, fading over frames (Rev Decay = tail length), mixed dry/wet by Rev Mix; Rev Mix 0 (or Rev Dry) is a transparent dry passthrough (its blur passes skipped). Patch a second source into B and pick a COMPOSITE mode to have B modulate A grains region-by-region: density-map (B brightness thins/thickens grains), displace (B chroma warps where grains read from), size-map (B scales grain size), rate-map (B scrubs the per-region history time); with only A patched it runs mono-source (composite off). TWO video outputs: OUT (the full chain) and GRAINS (the raw granular scatter tap, pre-feedback/pre-reverb, resolved via read outputTexture:grains — a clean grains-only output to key/mix elsewhere, optional). Rendered at half engine resolution (SwiftShader/CI budget). Like every video processor an unpatched input renders black; the defaults are tuned so any patched source is immediately alive. All ports live on the yellow drill-down PATCH PANEL (no raw side jacks). The grain window / hash / temporal-blend / feedback-UV / reverb-accumulate / composite-mode math is a 1:1 CPU mirror unit-tested in $lib/video/modules/grainsOfVision.

grains of visionin_avideoin_bvideodensitycvgrain_sizecvspraycvtime_spraycvratecvorientcvwindowcvfeedbackcvfb_decaycvfb_zoomcvfb_rotatecvrev_mixcvrev_sizecvrev_decaycvrev_diffusecvcompositecvcomp_amountcvoutvideograinsvideoaudiocvgatepitch

inputs

in_avideovideo
in_bvideovideo
densitycvCV -> density param.
grain_sizecvCV -> grain_size param.
spraycvCV -> spray param.
time_spraycvCV -> time_spray param.
ratecvCV -> rate param.
orientcvCV -> orient param.
windowcvCV -> window param.
feedbackcvCV -> feedback param.
fb_decaycvCV -> fb_decay param.
fb_zoomcvCV -> fb_zoom param.
fb_rotatecvCV -> fb_rotate param.
rev_mixcvCV -> rev_mix param.
rev_sizecvCV -> rev_size param.
rev_decaycvCV -> rev_decay param.
rev_diffusecvCV -> rev_diffuse param.
compositecvCV -> composite param.
comp_amountcvCV -> comp_amount param.

outputs

outvideovideo
grainsvideovideo

params

densitylinear2..48
grain_sizelinear0.2..2.5
spraylinear0..1
time_spraylinear0..1
ratelinear0..1
orientlinear0..1
windowlinear0..1
feedbacklinear0..0.98
fb_decaylinear0..1
fb_zoomlinear?..?
fb_rotatelinear?..?
fb_drydiscrete0..1
rev_mixlinear0..1
rev_sizelinear0..1
rev_decaylinear0..0.99
rev_diffuselinear0..1
rev_drydiscrete0..1
compositediscrete0..?
comp_amountlinear0..1
freezelinear0..1
source · grainsOfVision.ts
luma effects

luma is a luminance-domain color processor for a single video stream. It reads the Rec. 601 brightness (0.299/0.587/0.114) of every pixel, runs that luma through a chain of gamma, contrast (scaled around the 0.5 midpoint), posterize (quantize to N steps; 16 = off), then an additive bias, and finally re-applies the new-luma/old-luma ratio to all three RGB channels so chroma (hue and saturation) is preserved while only tonality changes. Gamma uses the Levels-style INVERSE convention pow(luma, 1/gamma): values above 1 brighten midtones, below 1 darken them (this is the Photoshop-Levels convention, not display-gamma out = in^gamma). Patch a video source into in and use it to crush blacks, lift gamma, flatten the image into hard tonal bands, or shift overall brightness; with the defaults (gamma 1, cntr 1, post 16, bias 0) the transfer is a true identity — the picture passes through untouched. Note this is NOT a keyer — for foreground/background luma compositing use lumakey instead.

lumainvideogammacvcontrastcvposterizeLevelscvbiascvoutvideoaudiocvgatepitch

inputs

invideovideo
gammacvCV -> gamma param.
contrastcvCV -> contrast param.
posterizeLevelscvCV -> posterizeLevels param.
biascvCV -> bias param.

outputs

outvideovideo

params

gammalinear0.1..3
contrastlinear0..2
posterizeLevelsdiscrete2..16
biaslinear-0.5..0.5
source · luma.ts
lumakey effects

lumakey is a two-input luminance-key compositor: it lays a foreground frame over a background frame and decides, pixel by pixel, which one shows through based on how bright the foreground is. It computes Rec. 601 luma of the foreground, then builds an alpha mask with smoothstep(threshold - softness, threshold + softness, luma) so bright foreground pixels become opaque (alpha 1, foreground shows) and dark ones drop out (alpha 0, background bleeds through), finally mixing background toward foreground by that alpha. Use it to matte out a black or white plate behind a source, drop text/letterbox overlays onto a scene, or composite a bright source over another video; flip invert to key on the dark areas instead. With no foreground patched it passes the background straight through so a half-wired chain is never a black hole.

lumakeyfgvideobgvideothresholdcvsoftnesscvinvertcvoutvideoaudiocvgatepitch

inputs

fgvideovideo
bgvideovideo
thresholdcvCV -> threshold param.
softnesscvCV -> softness param.
invertcvCV -> invert param.

outputs

outvideovideo

params

thresholdlinear0..1
softnesslinear0..0.5
invertdiscrete0..1
source · lumakey.ts
mapper effects

Video KEYER / MATTE processor. Shows a VIDEO input ONLY where a KEY input is active, BLACK everywhere else — a generalisation of OUTLINES' `mapped` output (which showed its video input only where ≥2 shapes overlapped) to an ARBITRARY key. STATELESS per frame: the keyed region moves/transforms live with the key source (no feedback, no history) — a pure function of the current video frame, the current key frame, and the THRESHOLD knob. Algorithm (per output texel): read the KEY input's Rec. 601 LUMINANCE (the same luma weights LUMA / EDGES / LUMAKEY use), mask = smoothstep(threshold − 0.03, threshold + 0.03, keyLuma) (a sub-pixel-small soft edge band around the cutoff that keeps the key effectively CRISP — mask → 1 well above threshold, 0 well below — while removing the 1-texel aliasing a hard step shows on a moving key), then out = video × mask (video shows where the key is bright; fades to black below threshold). THRESHOLD (0..1, default 0.5): the key cutoff — RAISE it to SHRINK the keyed area (only the brightest key regions pass), LOWER it to GROW it (dimmer key regions pass too); this is the knob OUTLINES.mapped hard-coded to "≥2 overlaps". THRESHOLD has a matching CV input (port id == param id). VIDEO takes RGB; KEY is declared `video` so BOTH a colour video source AND a MONO-VIDEO source (white-on-black SHAPES / LINES / EDGES output, which upcasts to video for free) can drive it — its luminance is the mask. A half-patched MAPPER (missing VIDEO or KEY) is intentionally BLACK (mirrors OUTLINES.mapped's unpatched-video behaviour) so an unfinished chain reads as "not done yet" rather than passing the raw video through unkeyed. Usage: patch a source → VIDEO, a high-contrast matte (SHAPES / LINES / EDGES / a CAMERA luma) → KEY, OUT → OUTPUT or a video mixer; sweep THRESHOLD to wipe the keyed window open/closed, or modulate it with a CV/LFO for an animated reveal.

mappervideovideokeyvideothresholdcvoutvideoaudiocvgatepitch

inputs

videovideovideo
keyvideovideo
thresholdcvCV -> threshold param.

outputs

outvideovideo

params

thresholdlinear0..1
source · mapper.ts
posterbox effects

POSTERBOX — retro PALETTE-CRUSH (posterizer) video PROCESSOR. Takes a video input and truncates every pixel to an authentic retro per-channel bit allocation — the classic "8-bit"/"hi-colour" palette crush. This is the dedicated home of the per-channel RGB posterize looks CELLSHADE's rebuild dropped (they are posterization, not cel shading): the 8-bit RGB 3-3-2 and 16-bit RGB 5-6-5 floor-quantization paths are ported EXACTLY, so an old cellshade retro patch recreates byte-for-byte by swapping in POSTERBOX. "Tints neutral grays" is a FEATURE, not a bug — an asymmetric allocation has different level grids per channel, so gray 0.2 at 3-3-2 quantizes to (36,36,0), a dark olive; that channel-clipped cast IS the period-correct look. DEPTH is a 5-step DISCRETE knob (the param is the step INDEX 0..4; the card shows the allocation name + palette size, and the matching CV input uses a discrete cvScale so it snaps to the 5 steps) stepping the ladder: 1-1-1 = 8 colours (3-bit RGB, ZX-Spectrum brutal), 2-2-2 = 64 (EGA master palette), 3-3-2 = 256 (VGA-era 8-bit truecolor, the default), 4-4-4 = 4096 (Amiga OCS), 5-6-5 = 65536 (RGB565 hi-colour, subtle). DITHER (0..1, default 0) is the classic companion: a Bayer 4×4 ordered dither that perturbs the quantizer threshold per screen pixel (the same offset-before-truncate scheme the PlayStation used before truncating to 15-bit) — at 0 the palette bands are HARD (the pure legacy crush); raising it dissolves band edges into alternating checkered pixels so gradients render as retro cross-hatch instead of banding. MIX (0..1, default 1) is a straight dry/wet. DEPTH / DITHER / MIX each have a matching CV input (port id == param id). STATELESS per frame — one texture sample + one Bayer lookup per pixel (single-pass shader, no neighbourhood taps). IN takes RGB; OUT is video — patch a source (CAMERA / VIDEOBOX / SHAPES / a generator) → IN, OUT → OUTPUT or a video mixer; step DEPTH for the era, raise DITHER for the cross-hatch, back off MIX to soften. All ports live on the yellow drill-down PATCH PANEL (no raw side jacks). The pure quantizer + Bayer math is unit-tested in $lib/video/modules/posterbox (the exact CPU mirror of the shader).

posterboxinvideodepthcvdithercvmixcvoutvideoaudiocvgatepitch

inputs

invideovideo
depthcvCV -> depth param.
dithercvCV -> dither param.
mixcvCV -> mix param.

outputs

outvideovideo

params

depthdiscrete0..?
ditherlinear0..1
mixlinear0..1
source · posterbox.ts
reverb effects

The plain room — Faust's mono Freeverb (8 parallel damped comb filters into 4 series Schroeder allpasses), mono in / mono out, three knobs, no CV. The comb taps are FIXED (25.3–36.7 ms), so SIZE is decay TIME (comb feedback 0.50–0.95, measured audible T60 ~0.33 s to ~4.4 s — never infinite), not room size; DAMP is the one-pole lowpass inside each comb's feedback, darkening AND shortening the tail until at 1 the loop closes and only ~0.14 s of allpass diffusion is left; MIX is a linear dry/wet crossfade. Caveat: the tank is unscaled, so the wet leg is ~+10 dB (up to +18 dB at SIZE 1) hotter than the dry — MIX is also a loudness control and fully wet + large will clip. Reach for SHIMMERSHINE for an octave-up tail, CLOUDSEED for a real diffusion engine, MOOG905 for spring.

reverbaudioaudioaudioaudioaudiocvgatepitch

inputs

audioaudioPre-reverb mono in / wet+dry mix out.

outputs

audioaudioPre-reverb mono in / wet+dry mix out.

params

sizelinear0..1(default 0.5)
damplinear0..1(default 0.3)
mixlinear0..1(default 0.3)
source · reverb.ts
ringback effects

Stereo crush effect — the TWOTRACKS record-time artifact, extracted and made intentional. While TWOTRACKS fresh-records it writes the live input into INTEGER ring-buffer cells (sample-quantized) at a fractional, varispeed write/read cursor, then reads those same cells back with LINEAR INTERPOLATION at the fractional cursor; the integer-cell write versus the interpolated read makes the read-back a decimated, aliased copy of the input — a metallic "bitcrushed" tone. (That read-back used to leak into TWOTRACKS' monitor while recording, which was a bug; RINGBACK packages the EXACT same mechanism as a deliberate effect.) Stereo in (L IN / R IN) → stereo out (L OUT / R OUT); a mono input is mirrored to both channels. Two independent ring channels (L + R) run the per-sample loop: read = interp(buf, cursor); write buf cells [cursor, cursor+RATE) = input + FEEDBACK·read; cursor += RATE (wrapping the small ring); out = (1−MIX)·input + MIX·read. Four knobs expose the character, all derived directly from the mechanism: RATE (0.05..4, default 0.5) is the write/read cursor advance per sample and the "amount" of the artifact — 1 is the mildest, below 1 the read-back stair-steps and aliases hardest; SIZE (2..4096 samples, default 64, log) is the ring length — a few samples ring like a comb/short metallic resonance, larger sizes become a grainy short-delay smear; FEEDBACK (0..0.98, default 0.3) re-injects the read-back into the ring (the regen "ring" tail), clamped strictly below 1 so it can never self-amplify to infinity; MIX (0..1, default 1) is the dry/wet blend between the clean input and the crushed read-back (0 passes the input through unchanged). The DSP is pure and deterministic (no RNG, no time dependence) so it is stable for VRT/ART; the worklet runs the shared RingChannel core in ringback-core.ts (unit-tested), the same no-mirror discipline as the TWOTRACKS engine. Patch any stereo (or mono) source through it for lo-fi grit, comb-ring resonance, or — at high feedback and small size — a self-oscillating metallic drone.

ringbackin_laudioin_raudioratecvsizecvfeedbackcvmixcvout_laudioout_raudioaudiocvgatepitch

inputs

in_laudioAudio signal.
in_raudioAudio signal.
ratecvCV -> rate param.
sizecvCV -> size param.
feedbackcvCV -> feedback param.
mixcvCV -> mix param.

outputs

out_laudioAudio signal.
out_raudioAudio signal.

params

ratelinear?..?
sizesmp?..?
feedbacklinear?..?
mixlinear?..?
source · ringback.ts
shimmershine effects

Stereo shimmer reverb. Schroeder-style tank (4 parallel comb filters with damped feedback + 2 series allpasses per channel) feeds a +12-semitone granular-fade pitch shifter; the shifted signal is summed back into the tank input (gain hard-capped at 0.55 to prevent runaway). Decay sets tank tail length, Shimmer the pitch-shifted feedback amount (0 = plain reverb, 1 = strong octave-up halo), Size the comb-feedback scale, Damp the in-loop high-frequency rolloff, Mix dry/wet. More processor-intensive than the plain Reverb module by design.

shimmershinein_laudioin_raudiodecay_cvcvshimmer_cvcvsize_cvcvmix_cvcvout_laudioout_raudioaudiocvgatepitch

inputs

in_laudioAudio signal.
in_raudioAudio signal.
decay_cvcvCV -> decay param.
shimmer_cvcvCV -> shimmer param.
size_cvcvCV -> size param.
mix_cvcvCV -> mix param.

outputs

out_laudioAudio signal.
out_raudioAudio signal.

params

decaylinear0..1(default 0.6)
shimmerlinear0..1(default 0.4)
sizelinear0..1(default 0.6)
damplinear0..1(default 0.4)
mixlinear0..1(default 0.4)
source · shimmershine.ts
sourcery effects

SOURCERY — a two-input region-transplant recolorizer video PROCESSOR. It edge-detects video A (top) and video B (bottom), segments each edge map into bounded regions (the connected non-edge areas walled off by the detected edges), then for every region in A finds the B region most similar in SHAPE (angles + geometry) first and SIZE second, and paints A's region with B's colors placed at the SAME relative position inside the shape (a corner of A samples the matching corner of B). A B shape may be reused by many A regions and EVERY part of A maps to some region (tiny/culled regions and the edge walls are absorbed into their nearest surviving region, so the output has no holes — the whole-screen background becomes one giant region filled by some B shape). Two global controls move all the transferred color: SKEW rotates the hue of every filled pixel (bipolar, 0.5 = no shift), ROT rotates the sampling frame inside each region (bipolar, 0.5 = no rotation). The look is a shifting stained-glass / photomosaic where A's edge structure is the cell boundaries and each cell is a warped fragment of B chosen by shape similarity; region boundaries are intentionally BLOCKY (segmentation runs at a coarse 128×96 grid, nearest-upscaled) while the colors are full-res sharp. For real-time performance the shape/segmentation stage is temporally amortized (recomputed every few frames) while the color fill sampling live B runs every frame; on live noisy video at low threshold the regions shimmer/boil frame-to-frame (a disclosed v1 limitation). The CCL, moments, Hu shape descriptors, z-score match and rel→uvB transform are a 1:1 mirror of the pure, unit-tested $lib/video/sourcery-core; the two THRESHOLD knobs (each + a CV input) gate A/B segmentation. Patch a structural source into A and a colorful source into B; with nothing in B the module passes A through (hue-skewed only).

sourceryavideobvideothresholdAcvthresholdBcvcolorSkewcvrotatecvoutvideoaudiocvgatepitch

inputs

avideovideo
bvideovideo
thresholdAcvCV -> thresholdA param.
thresholdBcvCV -> thresholdB param.
colorSkewcvCV -> colorSkew param.
rotatecvCV -> rotate param.

outputs

outvideovideo

params

thresholdAlinear0..1
thresholdBlinear0..1
colorSkewlinear0..1
rotatelinear0..1
source · sourcery.ts
tiler effects

TILER — a video MULTISCREEN / TILE effect PROCESSOR (the classic video-mixer "multiscreen" look). Repeats the input frame in an N×N grid: each cell shows the FULL input scaled to 1/N, so the tiled copies are lower-resolution by nature (a 4×4 grid is 16 thumbnails of the same source, a 16×16 grid is 256 tiny copies). STATELESS per frame — the tiling moves/transforms live with the source (no feedback, no history). Implemented as a single-pass fragment shader; the whole effect is one line: color = texture(input, fract(uv × N)) — uv×N stretches the 0..1 UV across N cells and fract() wraps each cell back to the full input, so every cell samples the entire source. TILE is a 6-step DISCRETE knob (the param is a step INDEX 0..5; the card shows the resulting grid, e.g. "8×8") mapping to the grid dimension N: idx 0 → N=1 (1:1 PASSTHROUGH, no tiling — the lowest step is deliberately a transparent inline node), 1 → 4×4, 2 → 6×6, 3 → 8×8, 4 → 12×12, 5 → 16×16. A matching TILE CV input (port id tile_cv, paramTarget tile, DISCRETE cvScale) MODULATES the grid: the CV snaps onto the index steps and SUMS into the knob index (the same plumbing every per-param CV input uses), and the module then SNAPS the summed (possibly fractional) value to the NEAREST VALID N — so a CV that nudges the knob a little past "6" lands cleanly on 8 (never an invalid 7×7), and a bipolar LFO sweeps the grid through the valid sizes. IN takes RGB; OUT is video — patch a source (CAMERA / VIDEOBOX / SHAPES / a generator) → IN, OUT → OUTPUT or a video mixer; dial TILE for the multiscreen grid or modulate tile_cv for a pulsing/animated grid. All ports live on the yellow drill-down PATCH PANEL (no raw side jacks). The pure knob→N mapping + the CV sum-then-snap-to-nearest-N math are unit-tested helpers in $lib/video/modules/tiler.

tilerinvideotile_cvcvoutvideoaudiocvgatepitch

inputs

invideovideo
tile_cvcvCV -> tile param.

outputs

outvideovideo

params

tilediscrete0..?
source · tiler.ts
twotracks effects

Two independent tape decks in one box, mixed to a stereo output. Each reel (A and B) records the stereo audio at its own L/R inputs onto a fixed-length blank tape, then plays the take back: patch audio in, arm with the ARM gate or fire the REC gate, and the tape records destructively (TAPE mode) or layers sound-on-sound (OVERDUB). Set a loop window by dragging the START and END markers on the reel picture, and drag anywhere else on it to scrub the playhead. RATE is varispeed — 1 is forward unity, 0 freezes the tape, negative plays it backwards, and it pitches the audio the way a real reel does; ECHOES (1–5) sets how many times the loop re-circulates and decays like a tape echo. Each reel then has its own 3-band EQ and a multimode filter (OFF / HP / LP / BP) to colour the playback. Globally, the A/B crossfader blends the two reels, A→B and B→A cross-feed one reel into the other for runaway tape textures, LOFI adds four grades of tape degradation, and MONITOR passes the live input through so you can hear what you are about to record. Every transport event has a gate input, so a sequencer can drive both reels by cable, and RATE CV per reel sweeps the full varispeed range for wow, flutter and tape-stops. SAVE TAPE exports a reel as a stereo 48 kHz 16-bit WAV, and a recorded take rides along in a saved performance.

twotracksaudio_l_in_aaudioaudio_r_in_aaudiorec_start_agaterec_arm_agateoverdub_agaterate_cv_acvaudio_l_in_baudioaudio_r_in_baudiorec_start_bgaterec_arm_bgateoverdub_bgaterate_cv_bcvout_laudioout_raudioaudiocvgatepitch

inputs

audio_l_in_aaudioAudio signal.
audio_r_in_aaudioAudio signal.
rec_start_agateGate signal (rising/falling edge).
rec_arm_agateGate signal (rising/falling edge).
overdub_agateGate signal (rising/falling edge).
rate_cv_acvCV -> rate_a param.
audio_l_in_baudioAudio signal.
audio_r_in_baudioAudio signal.
rec_start_bgateGate signal (rising/falling edge).
rec_arm_bgateGate signal (rising/falling edge).
overdub_bgateGate signal (rising/falling edge).
rate_cv_bcvCV -> rate_b param.

outputs

out_laudioAudio signal.
out_raudioAudio signal.

params

rate_alinear-3..3(default 1)
mode_adiscrete0..1(default 1)
echoes_adiscrete1..5(default 3)
start_alinear0..1(default 0)
end_alinear0..1(default 1)
overdub_flag_adiscrete0..1(default 0)
eqLow_adB-12..12(default 0)
eqMid_adB-12..12(default 0)
eqHigh_adB-12..12(default 0)
filterMode_adiscrete0..3(default 0)
cutoff_aHz20..20000(default 20000)
reso_alinear0..1(default 0)
rate_blinear-3..3(default 1)
mode_bdiscrete0..1(default 1)
echoes_bdiscrete1..5(default 3)
start_blinear0..1(default 0)
end_blinear0..1(default 1)
overdub_flag_bdiscrete0..1(default 0)
eqLow_bdB-12..12(default 0)
eqMid_bdB-12..12(default 0)
eqHigh_bdB-12..12(default 0)
filterMode_bdiscrete0..3(default 0)
cutoff_bHz20..20000(default 20000)
reso_blinear0..1(default 0)
ablinear0..1(default 0)
a2blinear0..1(default 0)
b2alinear0..1(default 0)
lofidiscrete0..3(default 0)
monitordiscrete0..1(default 0)
source · twotracks.ts
vdelay effects

A video delay line with feedback echo — the visual analog of a tape/analog audio echo for the picture domain. VDELAY keeps a ring of 32 frame buffers; each frame a WRITE pass renders a new head slot equal to the live input plus a feedback-attenuated copy of the slot one delay-time ago, so the same image re-enters the ring and decays into a chain of repeats spaced by the delay length (this frame, then N frames later, then 2N, 3N...). A separate COMPOSE pass produces the visible output as a dry/wet mix between the live input and that delayed tap, so at low Mix you see the source with a faint trailing ghost and at high Mix you see mostly the echoes. With short Time and high Feedback you get fast, dense smearing/trails; long Time gives discrete stutter-style repeats. Color multiplicatively tints the feedback path toward a warm magenta, and because it is applied each pass the trails drift in hue (and darken slightly) as they age. Wire a video source into IN and route OUT into an OUTPUT, MONOGLITCH, or RUTTETRA card to watch the trails; push Feedback toward 0.95 for long-lived feedback ghosts without runaway.

vdelayinvideotime_cvcvfeedback_cvcvmix_cvcvoutvideoaudiocvgatepitch

inputs

invideovideo
time_cvcvCV -> delayTime param.
feedback_cvcvCV -> feedback param.
mix_cvcvCV -> mix param.

outputs

outvideovideo

params

delayTimelinear1..?
feedbacklinear0..0.95
mixlinear0..1
colorShiftlinear0..1
source · vdelay.ts
vst fx effects

Runs one of YOUR installed effect plugins (AU builds of your VSTs) as a stereo insert via the vst-bridge native helper — 100% wet, bit-transparent bypass while nothing is mounted, local bypass when the helper is off so a lane never goes silent.

vst fxin_laudioin_raudioout_laudioout_raudioaudiocvgatepitch

inputs

in_laudioAudio signal.
in_raudioAudio signal.

outputs

out_laudioAudio signal.
out_raudioAudio signal.
source · vst-fx.ts

Spectral-analysis resynthesizer — a port of the SPECTRAL engine of the Warren's Spectrum VST (a.k.a. CallSine, MIT-licensed). Runs a rolling 2048-point FFT over whatever is patched into AUDIO IN, picks the loudest sinusoidal peaks, ranks them by SALIENCE (a harmonic-series bonus, so thinning the bank collapses toward the fundamental rather than toward the loudest formant), tracks them frame to frame with McAulay-Quatieri matching, and rebuilds the sound as up to 256 oscillators. It also replays what the tracker DISCARDS: leftover bin energy is measured in 16 log-spaced bands and re-synthesised as band-passed noise (the SMS residual) — the difference between a vocoder and a voice. PARTIALS sets density and CPU; LOCK snaps partials onto a harmonic comb (self-disengaging on unpitched input); RESIDUAL fades the noise half; SLICE sets the analysis period over a full 2-200 ms (the plugin declares that range but internally clamps at ~21 ms — here all of it works); SHAPE morphs every partial sine→saw→square; FREEZE (control or GATE input) holds the current spectrum as a drone; FLOOR/STABILITY gate which peaks earn an oscillator; SLEW smears them in time; CENTER and a V/oct PITCH input transpose the whole bank post-analysis. Mono in, mono out, monophonic — it is an EFFECT, so nothing patched into AUDIO IN means silence. Phase 1: no filterbank, no WAVETABLE or MASSPASS engine, no built-in FX.

warren's spectrumaudio_inaudiopitchpitchgategatepartials_cvcvlock_cvcvresidual_cvcvshape_cvcvslice_cvcvcenter_cvcvoutaudioaudiocvgatepitch

inputs

audio_inaudioAudio signal.
pitchpitchV/oct pitch CV.
gategateGate signal (rising/falling edge).
partials_cvcvCV -> spectralPartials param.
lock_cvcvCV -> spectralLock param.
residual_cvcvCV -> spectralResidual param.
shape_cvcvCV -> spectralShape param.
slice_cvcvCV -> spectralSlice param.
center_cvcvCV -> spectralCenter param.

outputs

outaudioAudio signal.

params

engineModediscrete?..?
spectralBandCountdiscrete?..?
spectralPartialsdiscrete?..?
spectralLocklinear?..?
spectralResiduallinear?..?
spectralSlicems?..?
engineFreezediscrete?..?
spectralShapelinear?..?
spectralFloordB?..?
spectralStabdiscrete?..?
spectralSlews?..?
spectralCentercents?..?
resynthLevellinear?..?
inputMixlinear?..?
gaindB?..?
source · warrensspectrum.ts

utilities

4plexvid utilities

4PLEXVID is a 4-in / 4-out video router — the video sibling of the audio 4Plexer. It is NOT a blend or mixer: each of the four outputs carries exactly ONE of the four video inputs, a discrete cross-point switch. Every output has its own selector (sel1..sel4 picking IN1..IN4) and its own gate CV input that advances that selector by one on each rising edge (IN1→IN2→IN3→IN4→IN1, wrapping). The fragment shader is a pure passthrough copy of the selected input texture (it writes the input's RGB straight through, or solid black when that input is unpatched), so there is no color processing — pixels pass straight through. All four outputs render their own FBO every frame regardless of patch state, so downstream modules always sample a fresh texture; OUT1 is also exposed as the canonical single-texture surface. Use it to fan one set of sources out to four destinations, to swap which feed reaches a screen, or to drive rhythmic cuts by clocking the gate inputs from an LFO or sequencer.

4plexvidin1videoin2videoin3videoin4videogate1cvgate2cvgate3cvgate4cvout1videoout2videoout3videoout4videoaudiocvgatepitch

inputs

in1videovideo
in2videovideo
in3videovideo
in4videovideo
gate1cvCV -> gate1 param.
gate2cvCV -> gate2 param.
gate3cvCV -> gate3 param.
gate4cvCV -> gate4 param.

outputs

out1videovideo
out2videovideo
out3videovideo
out4videovideo

params

sel1discrete0..?
sel2discrete0..?
sel3discrete0..?
sel4discrete0..?
gate1linear0..1
gate2linear0..1
gate3linear0..1
gate4linear0..1
source · 4plexvid.ts
902 vca utilities

902 Voltage Controlled Amplifier (slice 3 of the moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). The classic moogafakkin DIFFERENTIAL VCA. A SIGNAL input is multiplied by a gain driven by a CONTROL SUM measured in volts: the manual GAIN pot ("fixed control voltage", 0..6 V) + the summing CONTROL INPUTS (cv, scaled by the CV-amount knob + sign) + a fixed-control-voltage bias input (fcv). Overall gain is x2 (+6 dB) at pot-max OR at CV = 6 V, and reaches its x3 ceiling near a control sum of ~7.5 V. The LIN / EXP RESPONSE switch picks the gain law: LINEAR rises linearly with the control voltage (6 V -> x2); EXPONENTIAL passes through the same x2 at 6 V then climbs faster, hitting x3 near ~7.5 V (the snappier VCA feel). Two complementary outputs form the differential pair: OUT (the amplified signal) and OUT- (audio_inv, its sample-accurate phase-inverted twin) — handy for stereo widening, sidechain feedback prevention, or mid/side work without a separate inverter. DSP is own-code: an amplifier gain law forked from the repo's own vca, re-implemented with the added exponential branch + the moogafakkin x2-at-6V / x3-ceiling scaling (not a port of any moogafakkin schematic or copyleft source - permissive only). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

902 vcaaudioaudiocvcvfcvcvaudioaudioaudio_invaudioaudiocvgatepitch

inputs

audioaudioSIGNAL input (the audio to be amplified) / OUT — the amplified signal (signal x gain, where gain follows the LIN/EXP law against the control sum).
cvcvSumming CONTROL INPUT. Scaled by the CV-amount knob (sign + depth) and summed onto the control voltage per-sample in the worklet (PASSTHROUGH_BY_DESIGN — the worklet owns the gain-law map + x3 clamp). CV = 6 V alone yields x2 (+6 dB).
fcvcvFixed-control-voltage bias — a second summing CONTROL INPUT added straight onto the control sum per-sample (PASSTHROUGH_BY_DESIGN). Push the FCV + pot sum to 9 V to reach the x3 ceiling in the shipped LINEAR mode, or to 7.5 V in EXPONENTIAL (#1912: this line used to name 7.5 V for both, which is the EXP arm figure).

outputs

audioaudioSIGNAL input (the audio to be amplified) / OUT — the amplified signal (signal x gain, where gain follows the LIN/EXP law against the control sum).
audio_invaudioOUT- — the differential - output: a sample-accurate phase-inverted twin of OUT (for stereo widening / sidechain / mid-side).

params

gainlinear0..1(default 0.5)
cvAmountlinear-1..1(default 1)
modediscrete0..1(default 0)
source · moog902.ts
961 interface utilities

961 Interface (moogafakkin System 55 clone — categorized under Ports -> moogafakkin). A trigger-format converter / interface: audio crossing the SENSITIVITY threshold fires V-triggers (two parallel outs); an S-trigger input passes through to the V-trigger outs; and V-trigger inputs convert to S-trigger outs — one matching the input gate duration, one re-shaped to a fixed SWITCH-ON-TIME pulse (40 ms..4 s). (In our graph all triggers are gates; the S/V polarity distinction is cosmetic — the timing behaviors are modeled.) Own-code. Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

961 interfaceaudio_inaudios_ingatev_in_agatev_in_bgatev_out1gatev_out2gates_out_agates_out_bgateaudiocvgatepitch

inputs

audio_inaudioAudio signal.
s_ingateGate signal (rising/falling edge).
v_in_agateGate signal (rising/falling edge).
v_in_bgateGate signal (rising/falling edge).

outputs

v_out1gateGate signal (rising/falling edge).
v_out2gateGate signal (rising/falling edge).
s_out_agateGate signal (rising/falling edge).
s_out_bgateGate signal (rising/falling edge).

params

sensitivitylinear0..1(default 0.5)
switchOnTimes0.04..4(default 0.2)
source · moog961.ts
962 seq switch utilities

962 Sequential Switch (moogafakkin System 55 clone — categorized under Ports -> moogafakkin). Routes one of up to three signal inputs to a single output, advancing to the next input on each SHIFT (V-trigger) rising edge — a gate-advanced selector (shares the FOURPLEXER selector logic, trimmed to 3-in/1-out). STAGES sets how many inputs are cycled (2 or 3). Own-code. Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

962 seq switchin1cvin2cvin3cvshiftgateoutcvaudiocvgatepitch

inputs

in1cvControl voltage.
in2cvControl voltage.
in3cvControl voltage.
shiftgateGate signal (rising/falling edge).

outputs

outcvControl voltage.

params

stagesdiscrete2..3(default 3)
source · moog962.ts
984 matrix utilities

984 4-Channel Matrix Mixer (moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). A 4-in x 4-out matrix: each of the 16 cross-points (m_ij) has an independent level knob, so any input can be summed into any output at any amount (out_j = sum over i of in_i * m_ij). Cross-points default to 0 (a fresh matrix is silent until dialed). Own-code gain matrix (permissive). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

984 matrixin1audioin2audioin3audioin4audioout1audioout2audioout3audioout4audioaudiocvgatepitch

inputs

in1audioAudio signal.
in2audioAudio signal.
in3audioAudio signal.
in4audioAudio signal.

outputs

out1audioAudio signal.
out2audioAudio signal.
out3audioAudio signal.
out4audioAudio signal.
source · moog984.ts
994 mult utilities

994 Dual Multiples (moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). Two independent passive MULTIPLES: each input is fanned out unaltered to three paralleled outputs (a_in -> a1/a2/a3, b_in -> b1/b2/b3). Type-agnostic — splits audio or CV alike. No knobs, no DSP (a unity passthrough split in the factory). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

994 multa_inaudiob_inaudioa1audioa2audioa3audiob1audiob2audiob3audioaudiocvgatepitch

inputs

a_inaudioAudio signal.
b_inaudioAudio signal.

outputs

a1audioAudio signal.
a2audioAudio signal.
a3audioAudio signal.
b1audioAudio signal.
b2audioAudio signal.
b3audioAudio signal.
source · moog994.ts
995 atten utilities

995 Attenuators (moogafakkin System 55/35 clone — categorized under Ports -> moogafakkin). Three independent passive variable ATTENUATORS, each input -> level knob (0..unity) -> output. Reduces control or audio amplitude (own-code per-channel gain, permissive). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

995 attenin1audioin2audioin3audioout1audioout2audioout3audioaudiocvgatepitch

inputs

in1audioAudio signal.
in2audioAudio signal.
in3audioAudio signal.

outputs

out1audioAudio signal.
out2audioAudio signal.
out3audioAudio signal.

params

atten1linear0..1(default 1)
atten2linear0..1(default 1)
atten3linear0..1(default 1)
source · moog995.ts

Analog-logic mixer inspired by Mystic Instruments ANA (hardware-only — this is a from-spec implementation, not a port). Two continuous-signal inputs A and B feed bipolar attenuverters (-1..+1) and the post-attenuverter signals fan out into FIVE simultaneous algebraic outputs: MIN = min(A',B'), MAX = max(A',B'), DIFF = A'-B', SUM = tanh(A'+B') (soft-clipped), PRODUCT = tanh(A'*B') (soft-clipped, gives ring-mod-ish behavior for audio + smooth blending for CV). MIN/MAX of two waveforms mashes shapes; MAX of two envelopes = "either-trigger fires"; DIFF of two LFOs is anti-correlated motion; PRODUCT of two CVs is smooth blending. Continuous-signal "analog logic" — NOT the digital boolean logic that ILLOGIC ships. Tanh soft-clip on SUM + PRODUCT only (the operations that can leave [-1, +1]); MIN/MAX/DIFF stay bounded naturally.

analoglogicmathsacvbcvattA_cvcvattB_cvcvmincvmaxcvdiffcvsumcvproductcvaudiocvgatepitch

inputs

acvSignal input A (cv/audio, bipolar). Multiplied by attA before the math.
bcvSignal input B (cv/audio, bipolar). Multiplied by attB before the math.
attA_cvcvCV → Att A attenuverter knob (linear scale, bipolar -1..+1).
attB_cvcvCV → Att B attenuverter knob (linear scale, bipolar -1..+1).

outputs

mincvSample-wise MIN(A', B') where A'/B' are the attenuverted inputs.
maxcvSample-wise MAX(A', B').
diffcvSample-wise DIFF: A' - B'. Anti-symmetric (DIFF(a,b) = -DIFF(b,a)).
sumcvSample-wise SUM with tanh soft-clip: tanh(A' + B'). Stays in (-1, +1) for any inputs.
productcvSample-wise PRODUCT with tanh soft-clip: tanh(A' * B'). Audio × audio = ring mod; CV × CV = smooth blending.

params

attAlinear-1..1(default 1)
attBlinear-1..1(default 1)
source · analog-logic-maths.ts
attenumix utilities

The simple mixer — a 4-channel attenuating mixer with per-channel direct outs and a master gain. Each channel's level is knob + CV summed and clamped to 0..1 (attenuators only attenuate, never boost), giving a per-channel direct out; all four sum into a master (0..2) with a tanh soft-clip so pushing the master past unity stays musical. Compared to VEILS (same quad-VCA-plus-mix topology) ATTENUMIX has no per-channel boost and no linear/exponential toggle — it is the no-surprises "the mixer" where every knob does exactly what it says. CV inputs are passthrough-by-design so a ±1 V LFO at knob=0 sweeps a channel's full open range.

attenumixin1audioin2audioin3audioin4audiocv1cvcv2cvcv3cvcv4cvout1audioout2audioout3audioout4audiomixaudioaudiocvgatepitch

inputs

in1audioAudio signal.
in2audioAudio signal.
in3audioAudio signal.
in4audioAudio signal.
cv1cvControl voltage.
cv2cvControl voltage.
cv3cvControl voltage.
cv4cvControl voltage.

outputs

out1audioAudio signal.
out2audioAudio signal.
out3audioAudio signal.
out4audioAudio signal.
mixaudioAudio signal.

params

att1linear0..1(default 0)
att2linear0..1(default 0)
att3linear0..1(default 0)
att4linear0..1(default 0)
masterlinear0..2(default 1)
source · attenumix.ts
chroma console utilities

Control surface for the Hologram Chroma Console pedal — sends MIDI CC to the hardware, carries no audio. All 34 documented CCs are available; eight assignable SLOTS back them with real parameters, so those eight are what clip automation, MIDI learn, Electra and the Push 2 card can drive. The pedal is receive-only, so the card shows what was sent, never what the pedal holds — PUSH ALL re-asserts every slot.

chroma consoleaudiocvgatepitch
source · chromaconsole.ts
clocked utilities

Self-contained mini-LIVECODE owning a single clocked() callback. Spawned by the parent LIVECODE card when you invoke clocked(division, fn); deleting the runner cancels the schedule. Body is editable inline; the audio-domain factory re-evaluates it on every division boundary derived from TIMELORDE.bpm.

clockedaudiocvgatepitch
source · clocked-runner.ts
cp3 mixer utilities

CP3 / CP3A Console Panel — the console mixer slice of the moogafakkin System 55/35 clone (categorized under Ports -> moogafakkin). A multi-function console: (1) a 4x1 summing mixer that presents a (+) output AND a (-) phase-inverted output simultaneously, max per-channel gain x2 (0.5 = unity, 1.0 = x2), mixing AC and/or DC voltages (audio AND cv alike — the per-sample sum is polarity- and DC-transparent); (2) the 4th input adds an EXTERNAL jack (ext4) plus an ATTENUATOR — at "10" (1.0) the attenuator is unity so a direct patch passes through unaltered; (3) a MULTIPLE — input 1 fanned out unaltered to three passthrough outs (1 -> 3); (4) trunk/reference jacks supplying a constant +12V and -6V reference (scaled into the project normalized CV convention). Four 25K-LIN input level knobs (shown 0-10) + the 4th-input attenuator. DSP is own-code: a forked + expanded version of the repo mixer (not a port of any moogafakkin schematic or copyleft source — permissive only). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family). v1 omits the CP3A trunk/routing-switch matrix (the reference jacks are modeled as constant sources); the switch matrix is a planned follow-up.

cp3 mixerin1audioin2audioin3audioin4audioext4cvout_positiveaudioout_negativeaudiomultiple_oneaudiomultiple_twoaudiomultiple_threeaudioplus_twelvecvminus_sixcvaudiocvgatepitch

inputs

in1audioMixer channel 1 input (audio or cv).
in2audioMixer channel 2 input (audio or cv).
in3audioMixer channel 3 input (audio or cv).
in4audioMixer channel 4 input (panel jack; audio or cv).
ext4cv4th-input EXTERNAL jack. Summed with in4 then scaled by the 4th-input ATTENUATOR (at "10"/1.0 = unity, direct patch passes unaltered). PASSTHROUGH_BY_DESIGN — it's the signal being attenuated, summed at audio-rate in the worklet, not a knob modulator.

outputs

out_positiveaudio(+) summed output: (in1*ch1 + in2*ch2 + in3*ch3 + ((in4+ext4)*att4)*ch4).
out_negativeaudio(-) output: the exact phase-inverse of the (+) output.
multiple_oneaudioMULTIPLE out 1 — in1 passthrough (1 -> 3 multiple).
multiple_twoaudioMULTIPLE out 2 — in1 passthrough (1 -> 3 multiple).
multiple_threeaudioMULTIPLE out 3 — in1 passthrough (1 -> 3 multiple).
plus_twelvecvConstant +12V trunk reference (normalized: +2.4 at +-5V = +-1).
minus_sixcvConstant -6V trunk reference (normalized: -1.2 at +-5V = +-1).

params

ch1linear0..1(default 1)
ch2linear0..1(default 1)
ch3linear0..1(default 1)
ch4linear0..1(default 1)
attenuator4linear0..1(default 1)
source · moog-cp3.ts
depolarizer utilities

DEPOLARIZER — a tiny 1-in / 1-out CV utility: the reverse of POLARIZER, converting a BIPOLAR control voltage back to a UNIPOLAR one. Model: out = 0.5 + DEPTH · (in / 2) — it folds a [−1, +1] input into [0, 1]. Computed sample-accurately by a pure Web Audio graph (a GainNode for the scale + a started ConstantSourceNode → GainNode for the fixed +0.5 center, both summed; no worklet, no DSP build). Controls — DEPTH: the single knob, range 0..1 on a LINEAR taper, sets how far the output DEPARTS from the 0.5 CENTER; default 1.0 = the FULL conversion (in=−1 → 0, in=0 → 0.5, in=+1 → 1), 0.5 → output swings only 0.25..0.75, 0 → flat 0.5. DEPTH attenuates only the DEVIATION from center (it scales the slope, not the offset), so the output always rests at the 0.5 unipolar center with nothing patched or at DEPTH 0 — the natural "neutral" value. IO — IN (cv): the bipolar (−1..+1) control voltage to depolarize (the affine map is defined for any value); OUT (cv): the unipolar result centered on 0.5. All patching is via the card's yellow drill-down PATCH PANEL — no side jacks. DEPTH is MIDI / control-surface assignable (right-click → MIDI Learn). Usage: feed a bipolar LFO / sequencer / ±1 modulation source into a destination that expects a 0..1 CV (a level / depth / mix-knob CV), with DEPTH trimming the modulation amount around the 0.5 rest point; the inverse of POLARIZER for the round trip.

depolarizerincvoutcvaudiocvgatepitch

inputs

incvThe BIPOLAR (−1..+1) control voltage to depolarize. CV-typed. The affine map out = 0.5 + depth·(in/2) is defined for any value.

outputs

outcvThe UNIPOLAR result centered on 0.5: out = 0.5 + depth·(in/2) (at depth 1: in=−1 → 0, in=0 → 0.5, in=+1 → 1). CV-typed.

params

depthlinear0..1(default 1)
source · depolarizer.ts
dockscope utilities

Slim 1u single-trace oscilloscope built for the workflow dock rails — the trace is vector-redrawn at live on-screen pixel size so it stays crisp at every dock zoom step. Terminal visualiser: ch1 in (accepts audio/CV/pitch/gate), no outputs.

dockscopech1audioaudiocvgatepitch

inputs

ch1audioAudio signal.

params

timeMsms1..200(default 20)
scalelog0.1..10(default 1)
rangediscrete0..1(default 0)
source · dockscope.ts
es-9 singleton utilities

Full 16×16 audio+CV I/O with a real Eurorack system via the Expert Sleepers ES-9 and the es9-bridge native companion app — every DC-coupled jack individually patchable, with per-jack audio/cv/pitch/gate voltage scaling.

es-9 · singletonout1audioout2audioout3audioout4audioout5audioout6audioout7audioout8audiousb1audiousb2audiousb3audiousb4audiousb5audiousb6audiousb7audiousb8audioin1audioin2audioin3audioin4audioin5audioin6audioin7audioin8audioin9audioin10audioin11audioin12audioin13audioin14audiospdif_laudiospdif_raudioin1_cvcvin2_cvcvin3_cvcvin4_cvcvin5_cvcvin6_cvcvin7_cvcvin8_cvcvin9_cvcvin10_cvcvin11_cvcvin12_cvcvin13_cvcvin14_cvcvaudiocvgatepitch

inputs

out1audioAudio signal.
out2audioAudio signal.
out3audioAudio signal.
out4audioAudio signal.
out5audioAudio signal.
out6audioAudio signal.
out7audioAudio signal.
out8audioAudio signal.
usb1audioAudio signal.
usb2audioAudio signal.
usb3audioAudio signal.
usb4audioAudio signal.
usb5audioAudio signal.
usb6audioAudio signal.
usb7audioAudio signal.
usb8audioAudio signal.

outputs

in1audioAudio signal.
in2audioAudio signal.
in3audioAudio signal.
in4audioAudio signal.
in5audioAudio signal.
in6audioAudio signal.
in7audioAudio signal.
in8audioAudio signal.
in9audioAudio signal.
in10audioAudio signal.
in11audioAudio signal.
in12audioAudio signal.
in13audioAudio signal.
in14audioAudio signal.
spdif_laudioAudio signal.
spdif_raudioAudio signal.
in1_cvcvControl voltage.
in2_cvcvControl voltage.
in3_cvcvControl voltage.
in4_cvcvControl voltage.
in5_cvcvControl voltage.
in6_cvcvControl voltage.
in7_cvcvControl voltage.
in8_cvcvControl voltage.
in9_cvcvControl voltage.
in10_cvcvControl voltage.
in11_cvcvControl voltage.
in12_cvcvControl voltage.
in13_cvcvControl voltage.
in14_cvcvControl voltage.

params

in1_classdiscrete0..3(default 1)
in2_classdiscrete0..3(default 1)
in3_classdiscrete0..3(default 1)
in4_classdiscrete0..3(default 1)
in5_classdiscrete0..3(default 1)
in6_classdiscrete0..3(default 1)
in7_classdiscrete0..3(default 1)
in8_classdiscrete0..3(default 1)
in9_classdiscrete0..3(default 1)
in10_classdiscrete0..3(default 1)
in11_classdiscrete0..3(default 1)
in12_classdiscrete0..3(default 1)
in13_classdiscrete0..3(default 1)
in14_classdiscrete0..3(default 1)
out1_classdiscrete0..3(default 0)
out2_classdiscrete0..3(default 0)
out3_classdiscrete0..3(default 0)
out4_classdiscrete0..3(default 0)
out5_classdiscrete0..3(default 0)
out6_classdiscrete0..3(default 0)
out7_classdiscrete0..3(default 0)
out8_classdiscrete0..3(default 0)
source · es9.ts
fader utilities

Two-source video mixer with a send/return FX loop. IN A and IN B are crossfaded by a horizontal A/B fader (0 = A, 1 = B); the crossfade SHAPE is picked from a transition dropdown — fade (uniform), wipe (soft edge sweeping left→right), dissolve (random per-cell reveal), star (a 5-point iris from the centre), or checkerboard (staggered cells). That A/B mix is exposed on the SEND output as a copy: patch SEND through any external video FX chain and bring the processed result back into RETURN. A second DRY/WET fader (with its own transition dropdown) blends the dry mix (0) against the wet return (1) to produce the main OUT — so you can fade the effect in and out, or transition into it with a wipe/dissolve/star/checker. 3 video inputs (A / B / RETURN), 2 video outputs (OUT = main mix, SEND = pre-FX copy). With nothing patched both outputs are black. The blend math is deterministic + unit-tested; both faders default to fade.

faderin_avideoin_bvideoreturnvideooutvideosendvideoaudiocvgatepitch

inputs

in_avideovideo
in_bvideovideo
returnvideovideo

outputs

outvideovideo
sendvideovideo

params

faderlinear0..1(default 0.5)
abTransitiondiscrete0..?(default 0)
dryWetlinear0..1(default 0)
dwTransitiondiscrete0..?(default 0)
source · fader.ts
flipper utilities

Gate flip-flop. Two gate inputs and two gate outputs (FLIP, FLOP). A gate on EITHER input alternately fires FLIP, then FLOP, then back — the first gate after load fires FLIP. While a gate is high it is mirrored to the currently-selected output (keeping the trigger width) and the other output stays silent. Use it to split one trigger stream into two alternating streams (e.g. ping-pong two envelopes / two voices).

flipperin1gatein2gateflipgateflopgateaudiocvgatepitch

inputs

in1gateGate signal (rising/falling edge).
in2gateGate signal (rising/falling edge).

outputs

flipgateGate signal (rising/falling edge).
flopgateGate signal (rising/falling edge).
source · flipper.ts
illogic utilities

Combined attenuverter / math / logic utility. 4 cv inputs feed bipolar attenuverters (-1..+1); post-attenuverter outputs sum into `sum` and `diff`. Inputs in1+in2 are also gate-thresholded (>= 0.5) and combined into AND/NAND/OR; in1 alone drives a NOT.

illogicin1cvin2cvin3cvin4cvatt1cvatt2cvatt3cvatt4cvsumcvdiffcvandgatenandgateorgatenotgateaudiocvgatepitch

inputs

in1cvInput 1 (cv/audio). Feeds att1 attenuverter AND the AND/NAND/OR/NOT logic block (gate-thresholded at 0.5).
in2cvInput 2 (cv/audio). Feeds att2 attenuverter AND the AND/NAND/OR logic block (gate-thresholded at 0.5).
in3cvInput 3 (cv/audio). Feeds att3 attenuverter only (no logic tap).
in4cvInput 4 (cv/audio). Feeds att4 attenuverter only (no logic tap).

outputs

att1cvin1 × bipolar attenuverter (-1..0..+1). Negative values invert sign.
att2cvin2 × bipolar attenuverter (-1..0..+1).
att3cvin3 × bipolar attenuverter (-1..0..+1).
att4cvin4 × bipolar attenuverter (-1..0..+1).
sumcvPost-attenuverter sum of all 4 channels: att1 + att2 + att3 + att4.
diffcvPost-attenuverter difference: (att1 + att2) - (att3 + att4).
andgateLogic AND of in1 & in2 as gates (threshold = 0.5). High when BOTH inputs >= 0.5.
nandgateLogic NAND of in1 & in2 as gates. NOT (in1 AND in2).
orgateLogic OR of in1 & in2 as gates. High when EITHER input >= 0.5.
notgateLogic NOT of in1 alone (single-input). High when in1 < 0.5.

params

att1_amountlinear-1..1(default 1)
att2_amountlinear-1..1(default 1)
att3_amountlinear-1..1(default 1)
att4_amountlinear-1..1(default 1)
source · illogic.ts
livecode utilities

JS-runtime live-coding module — CodeMirror editor with port-aware autocomplete and red-underline diagnostics, hit Run, the rack reshapes itself. Exposes spawn / patch / unpatch / set / read / clock.* / clocked() / log. Every clocked() call spawns a CLOCKED runner that owns the subscription. No audio I/O — the card is a side-tool. Full API + examples at /docs/modules/livecode.

livecodeaudiocvgatepitch
source · livecode.ts
mappy utilities

MAPPY — a multi-surface MANUAL projection mapper. Spawns up to SIX SURFACES; each surface is fed by a distinct video input (in1..in6) and warped onto its own DRAGGABLE QUAD in the output frame, then composited (painter's order, OVER) into ONE video output → a projector. Use it to DE-SKEW one awkwardly-angled projection (drag the four corners to match the physical screen) or to map up to 6 feeds onto the faces of a white cube (only ~3-4 faces are ever visible from one projector angle). WARP: each surface owns a 4-corner QUAD in NORMALIZED [0,1] output space (corner order TL, TR, BR, BL). The homography (unit-square → that quad) defines the projective warp; the shader runs per OUTPUT texel, applies the INVERSE homography to find the matching SOURCE uv, and samples the input there (sampling only where the source uv is inside [0,1], else transparent so under-layers show through). Surfaces composite in input order (in1 first … in6 last) with OVER blend. FIT vs CROP: each surface has its OWN FIT toggle (default ON; surfaces independent) — one cheap per-surface shader uniform, no extra pass/readback. FIT (zoom-fit) squeezes the WHOLE source [0,1]² into the quad; CROP windows the source at NATIVE scale — the box becomes a moveable window onto the source pinned 1:1 in output space, so MOVING the box pans across the source and RESIZING crops more/less (the quad still masks the shape). DRAG: grab a CORNER to pin it, or grab the surface INTERIOR and drag to move the whole quad bodily (on the card preview AND in the editor). GRIDS-FIRST: a fresh MAPPY shows ONE surface, and a live surface with NO input connected renders its NUMBERED CALIBRATION GRID (a per-surface-tinted checker + border + cross-hairs + a big 7-segment DIGIT naming the input that will feed it). So with nothing patched the output IS the grid(s) — set the geometry up on the physical faces FIRST (drag corners; +/− the SURFACE COUNT up to 6), THEN connect video: the instant inN is connected, surface N swaps grid→warped video in the quad you already mapped (surface↔input is fixed — no reassignment). The GRID toggle FORCES the grid on every live surface (a re-alignment override); connecting inN auto-activates surface N even beyond the count. CARD: a live composite PREVIEW with draggable corner handles + quad outlines (coloured per surface), a +/− surface counter, a MAP button that opens the FULL-WINDOW editor (large canvas, big precise corner-pin handles, drag-inside-to-move a surface, surface tabs, a per-surface FIT/CROP toggle, snap-to-grid), the GRID toggle, and a per-surface legend (focus + FIT/CROP + reset + a ●video / ○grid state). All ports live on the yellow drill-down PATCH PANEL (no raw side jacks). This is the MANUAL mapper — the camera-assisted AUTO-align (point a camera at the projection, solve the homography from detected features) is a LATER phase; there is no camera input and no CV by design. The pure 2D projective math lives in $lib/video/mappy-homography (DLT solve / apply / invert / column-major-for-GLSL), shared by the shader + the unit tests.

mappyin1videoin2videoin3videoin4videoin5videoin6videooutvideoaudiocvgatepitch

inputs

in1videovideo
in2videovideo
in3videovideo
in4videovideo
in5videovideo
in6videovideo

outputs

outvideovideo

params

showGridlinear0..1
surfaceCountlinear?..?
source · mappy.ts
mixer utilities

Four-channel mono summing mixer: out = (in1×Ch1 + in2×Ch2 + in3×Ch3 + in4×Ch4) × Master. Levels are LINEAR AMPLITUDE 0..1 (0.5 = −6 dB, 0.1 = −20 dB — fine fades live near the bottom of the travel), all default to unity, and all five are one-pole smoothed (≈23 ms) so moves are click-free but control-rate — never a VCA. The sum is NOT limited, clamped or headroom-compensated and Master maxes at 1.0 (attenuate only, no make-up gain), so four hot unity channels can leave at up to 4× full scale (+12 dB) and clip downstream: trim the channels or pull Master, and watch the face level meter. Audio cables only (the inputs declare no CV widening) — for per-channel CV, direct outs and soft-clip use ATTENUMIX; for stereo with EQ and aux sends use MIXMSTRS.

mixerin1audioin2audioin3audioin4audioaudioaudioaudiocvgatepitch

inputs

in1audioChannel 1 input.
in2audioChannel 2 input.
in3audioChannel 3 input.
in4audioChannel 4 input.

outputs

audioaudioAudio signal.

params

ch1linear0..1(default 1)
ch2linear0..1(default 1)
ch3linear0..1(default 1)
ch4linear0..1(default 1)
masterlinear0..1(default 1)
source · mixer.ts
mixmstrs utilities

8xstereo mixer with EQ, per-channel compressor (single-dial macro + power-user thresh/ratio), two stereo aux sends/returns, per-channel post-fader VU taps (read('levels') → number[8]). Multiple instances allowed. 81 params.

mixmstrsch1Laudioch1Raudioch2Laudioch2Raudioch3Laudioch3Raudioch4Laudioch4Raudioch5Laudioch5Raudioch6Laudioch6Raudioch7Laudioch7Raudioch8Laudioch8Raudioret1Laudioret1Raudioret2Laudioret2Raudioch1_volumecvch1_lowcvch1_midcvch1_highcvch1_threshcvch1_ratiocvch1_compEnablecvcomp1cvch1_send1cvch1_send2cvch2_volumecvch2_lowcvch2_midcvch2_highcvch2_threshcvch2_ratiocvch2_compEnablecvcomp2cvch2_send1cvch2_send2cvch3_volumecvch3_lowcvch3_midcvch3_highcvch3_threshcvch3_ratiocvch3_compEnablecvcomp3cvch3_send1cvch3_send2cvch4_volumecvch4_lowcvch4_midcvch4_highcvch4_threshcvch4_ratiocvch4_compEnablecvcomp4cvch4_send1cvch4_send2cvch5_volumecvch5_lowcvch5_midcvch5_highcvch5_threshcvch5_ratiocvch5_compEnablecvcomp5cvch5_send1cvch5_send2cvch6_volumecvch6_lowcvch6_midcvch6_highcvch6_threshcvch6_ratiocvch6_compEnablecvcomp6cvch6_send1cvch6_send2cvch7_volumecvch7_lowcvch7_midcvch7_highcvch7_threshcvch7_ratiocvch7_compEnablecvcomp7cvch7_send1cvch7_send2cvch8_volumecvch8_lowcvch8_midcvch8_highcvch8_threshcvch8_ratiocvch8_compEnablecvcomp8cvch8_send1cvch8_send2cvmaster_volumecvsend1Precvsend2Precvret1_volumecvret1_lowcvret1_midcvret1_highcvret2_volumecvret2_lowcvret2_midcvret2_highcvmasterLaudiomasterRaudiosend1Laudiosend1Raudiosend2Laudiosend2Raudioaudiocvgatepitch

inputs

ch1LaudioAudio signal.
ch1RaudioAudio signal.
ch2LaudioAudio signal.
ch2RaudioAudio signal.
ch3LaudioAudio signal.
ch3RaudioAudio signal.
ch4LaudioAudio signal.
ch4RaudioAudio signal.
ch5LaudioAudio signal.
ch5RaudioAudio signal.
ch6LaudioAudio signal.
ch6RaudioAudio signal.
ch7LaudioAudio signal.
ch7RaudioAudio signal.
ch8LaudioAudio signal.
ch8RaudioAudio signal.
ret1LaudioAudio signal.
ret1RaudioAudio signal.
ret2LaudioAudio signal.
ret2RaudioAudio signal.
ch1_volumecvCV -> ch1_volume param.
ch1_lowcvCV -> ch1_low param.
ch1_midcvCV -> ch1_mid param.
ch1_highcvCV -> ch1_high param.
ch1_threshcvCV -> ch1_thresh param.
ch1_ratiocvCV -> ch1_ratio param.
ch1_compEnablecvCV -> ch1_compEnable param.
comp1cvCV -> comp1 param.
ch1_send1cvCV -> ch1_send1 param.
ch1_send2cvCV -> ch1_send2 param.
ch2_volumecvCV -> ch2_volume param.
ch2_lowcvCV -> ch2_low param.
ch2_midcvCV -> ch2_mid param.
ch2_highcvCV -> ch2_high param.
ch2_threshcvCV -> ch2_thresh param.
ch2_ratiocvCV -> ch2_ratio param.
ch2_compEnablecvCV -> ch2_compEnable param.
comp2cvCV -> comp2 param.
ch2_send1cvCV -> ch2_send1 param.
ch2_send2cvCV -> ch2_send2 param.
ch3_volumecvCV -> ch3_volume param.
ch3_lowcvCV -> ch3_low param.
ch3_midcvCV -> ch3_mid param.
ch3_highcvCV -> ch3_high param.
ch3_threshcvCV -> ch3_thresh param.
ch3_ratiocvCV -> ch3_ratio param.
ch3_compEnablecvCV -> ch3_compEnable param.
comp3cvCV -> comp3 param.
ch3_send1cvCV -> ch3_send1 param.
ch3_send2cvCV -> ch3_send2 param.
ch4_volumecvCV -> ch4_volume param.
ch4_lowcvCV -> ch4_low param.
ch4_midcvCV -> ch4_mid param.
ch4_highcvCV -> ch4_high param.
ch4_threshcvCV -> ch4_thresh param.
ch4_ratiocvCV -> ch4_ratio param.
ch4_compEnablecvCV -> ch4_compEnable param.
comp4cvCV -> comp4 param.
ch4_send1cvCV -> ch4_send1 param.
ch4_send2cvCV -> ch4_send2 param.
ch5_volumecvCV -> ch5_volume param.
ch5_lowcvCV -> ch5_low param.
ch5_midcvCV -> ch5_mid param.
ch5_highcvCV -> ch5_high param.
ch5_threshcvCV -> ch5_thresh param.
ch5_ratiocvCV -> ch5_ratio param.
ch5_compEnablecvCV -> ch5_compEnable param.
comp5cvCV -> comp5 param.
ch5_send1cvCV -> ch5_send1 param.
ch5_send2cvCV -> ch5_send2 param.
ch6_volumecvCV -> ch6_volume param.
ch6_lowcvCV -> ch6_low param.
ch6_midcvCV -> ch6_mid param.
ch6_highcvCV -> ch6_high param.
ch6_threshcvCV -> ch6_thresh param.
ch6_ratiocvCV -> ch6_ratio param.
ch6_compEnablecvCV -> ch6_compEnable param.
comp6cvCV -> comp6 param.
ch6_send1cvCV -> ch6_send1 param.
ch6_send2cvCV -> ch6_send2 param.
ch7_volumecvCV -> ch7_volume param.
ch7_lowcvCV -> ch7_low param.
ch7_midcvCV -> ch7_mid param.
ch7_highcvCV -> ch7_high param.
ch7_threshcvCV -> ch7_thresh param.
ch7_ratiocvCV -> ch7_ratio param.
ch7_compEnablecvCV -> ch7_compEnable param.
comp7cvCV -> comp7 param.
ch7_send1cvCV -> ch7_send1 param.
ch7_send2cvCV -> ch7_send2 param.
ch8_volumecvCV -> ch8_volume param.
ch8_lowcvCV -> ch8_low param.
ch8_midcvCV -> ch8_mid param.
ch8_highcvCV -> ch8_high param.
ch8_threshcvCV -> ch8_thresh param.
ch8_ratiocvCV -> ch8_ratio param.
ch8_compEnablecvCV -> ch8_compEnable param.
comp8cvCV -> comp8 param.
ch8_send1cvCV -> ch8_send1 param.
ch8_send2cvCV -> ch8_send2 param.
master_volumecvCV -> master_volume param.
send1PrecvCV -> send1Pre param.
send2PrecvCV -> send2Pre param.
ret1_volumecvCV -> ret1_volume param.
ret1_lowcvCV -> ret1_low param.
ret1_midcvCV -> ret1_mid param.
ret1_highcvCV -> ret1_high param.
ret2_volumecvCV -> ret2_volume param.
ret2_lowcvCV -> ret2_low param.
ret2_midcvCV -> ret2_mid param.
ret2_highcvCV -> ret2_high param.

outputs

masterLaudioAudio signal.
masterRaudioAudio signal.
send1LaudioAudio signal.
send1RaudioAudio signal.
send2LaudioAudio signal.
send2RaudioAudio signal.

params

ch1_volumelinear0..1(default 0.8)
ch1_lowdB-12..12(default 0)
ch1_middB-12..12(default 0)
ch1_highdB-12..12(default 0)
ch1_threshdB-36..0(default -12)
ch1_ratiolinear1..10(default 2)
ch1_compEnablediscrete0..1(default 0)
comp1linear0..1(default 0)
ch1_send1linear0..1(default 0)
ch1_send2linear0..1(default 0)
ch2_volumelinear0..1(default 0.8)
ch2_lowdB-12..12(default 0)
ch2_middB-12..12(default 0)
ch2_highdB-12..12(default 0)
ch2_threshdB-36..0(default -12)
ch2_ratiolinear1..10(default 2)
ch2_compEnablediscrete0..1(default 0)
comp2linear0..1(default 0)
ch2_send1linear0..1(default 0)
ch2_send2linear0..1(default 0)
ch3_volumelinear0..1(default 0.8)
ch3_lowdB-12..12(default 0)
ch3_middB-12..12(default 0)
ch3_highdB-12..12(default 0)
ch3_threshdB-36..0(default -12)
ch3_ratiolinear1..10(default 2)
ch3_compEnablediscrete0..1(default 0)
comp3linear0..1(default 0)
ch3_send1linear0..1(default 0)
ch3_send2linear0..1(default 0)
ch4_volumelinear0..1(default 0.8)
ch4_lowdB-12..12(default 0)
ch4_middB-12..12(default 0)
ch4_highdB-12..12(default 0)
ch4_threshdB-36..0(default -12)
ch4_ratiolinear1..10(default 2)
ch4_compEnablediscrete0..1(default 0)
comp4linear0..1(default 0)
ch4_send1linear0..1(default 0)
ch4_send2linear0..1(default 0)
ch5_volumelinear0..1(default 0.8)
ch5_lowdB-12..12(default 0)
ch5_middB-12..12(default 0)
ch5_highdB-12..12(default 0)
ch5_threshdB-36..0(default -12)
ch5_ratiolinear1..10(default 2)
ch5_compEnablediscrete0..1(default 0)
comp5linear0..1(default 0)
ch5_send1linear0..1(default 0)
ch5_send2linear0..1(default 0)
ch6_volumelinear0..1(default 0.8)
ch6_lowdB-12..12(default 0)
ch6_middB-12..12(default 0)
ch6_highdB-12..12(default 0)
ch6_threshdB-36..0(default -12)
ch6_ratiolinear1..10(default 2)
ch6_compEnablediscrete0..1(default 0)
comp6linear0..1(default 0)
ch6_send1linear0..1(default 0)
ch6_send2linear0..1(default 0)
ch7_volumelinear0..1(default 0.8)
ch7_lowdB-12..12(default 0)
ch7_middB-12..12(default 0)
ch7_highdB-12..12(default 0)
ch7_threshdB-36..0(default -12)
ch7_ratiolinear1..10(default 2)
ch7_compEnablediscrete0..1(default 0)
comp7linear0..1(default 0)
ch7_send1linear0..1(default 0)
ch7_send2linear0..1(default 0)
ch8_volumelinear0..1(default 0.8)
ch8_lowdB-12..12(default 0)
ch8_middB-12..12(default 0)
ch8_highdB-12..12(default 0)
ch8_threshdB-36..0(default -12)
ch8_ratiolinear1..10(default 2)
ch8_compEnablediscrete0..1(default 0)
comp8linear0..1(default 0)
ch8_send1linear0..1(default 0)
ch8_send2linear0..1(default 0)
master_volumelinear0..1(default 0.8)
send1Prediscrete0..1(default 0)
send2Prediscrete0..1(default 0)
ret1_volumelinear0..1(default 1)
ret1_lowdB-12..12(default 0)
ret1_middB-12..12(default 0)
ret1_highdB-12..12(default 0)
ret2_volumelinear0..1(default 1)
ret2_lowdB-12..12(default 0)
ret2_middB-12..12(default 0)
ret2_highdB-12..12(default 0)
source · mixmstrs.ts
one to nine utilities

ONE TO NINE — a fixed 3×3 SCREEN SPLITTER. Takes ONE video input and divides it into a 3×3 grid of nine equal sub-rectangles; each grid CELL is exposed on its own video output (out1..out9), magnified to FILL the output frame. Designed to be used ALONGSIDE (but NOT wired to) MAPPY — feed each of up to nine projectors a different ninth of one source. CELL NUMBERING is READING ORDER: 1 = top-left, 2 = top-center, 3 = top-right, 4 = mid-left, 5 = CENTRE, 6 = mid-right, 7 = bottom-left, 8 = bottom-center, 9 = bottom-right. OUTPUT N carries ONLY the content of cell N (a 1/9 sub-rectangle of the input), scaled up to the full output frame — so each output is a low-res CROP of one ninth (expected + fine). The nine outputs are CLEAN crops: no grid lines, no numbers. MONITOR: the module's canonical surface (the on-card preview, also the VRT/blit target) shows the input with a 3×3 GRID overlaid and a big readable DIGIT 1..9 drawn in each cell, so the operator can SEE which cell feeds which output. The grid + numbers appear ONLY on the monitor — never in the outputs. GRID toggle: a switch on the card that hides the grid + numbers on the monitor (raw input passthrough) when off; ON by default since the numbered grid is the point of the monitor. No params required beyond the grid toggle (the 3×3 split is fixed). Internally one MONITOR fbo renders the grid+numbers monitor and nine CROP fbos render the clean per-cell crops; the crops are exposed to downstream consumers via read('outputTexture:out1'..'out9') (the multi-output escape hatch), the monitor as the canonical surface.texture. The y-UP vUv convention is handled in the pure cellSourceRect math (cell 1 samples HIGH v / LOW u) so cell 1 is genuinely the top-left and the drawn digits render upright. All ports live on the yellow drill-down PATCH PANEL (IN + OUT1..OUT9, no raw side jacks). USAGE: patch a source (CAMERA / a generator / a clip) → IN, read the numbered MONITOR to learn the layout, then patch each OUT N → its destination (a projector via videoOut, a recorder, a mixer). The pure cell→source-rect crop math lives in $lib/video/modules/onetonine (cellSourceRect / cellRow / cellCol), shared by the crop shader, the monitor digits, and the unit tests.

one to nineinvideoaudiocvgatepitch

inputs

invideovideo

params

showGriddiscrete0..1
source · onetonine.ts
polarizer utilities

POLARIZER — a tiny 1-in / 1-out CV utility that converts a UNIPOLAR control voltage to a BIPOLAR one. Model: out = (2·in − 1) · DEPTH — it takes a [0, 1] input and stretches it across [−1, +1]. Computed sample-accurately by a pure Web Audio graph (a GainNode for the scale + a started ConstantSourceNode → GainNode for the offset, both summed; no worklet, no DSP build). Controls — DEPTH: the single bipolar-swing knob, range 0..1 on a LINEAR taper; default 1.0 = the FULL ±1 conversion (in=0 → −1, in=0.5 → 0, in=1 → +1), 0.5 → ±0.5, 0 → flat 0. DEPTH scales the swing symmetrically about 0, so the output always stays centered on 0 as you trim it. IO — IN (cv): the unipolar (0..1) control voltage to polarize (the affine map is defined for any value, it just linearly centers + scales); OUT (cv): the bipolar result, out = (2·in − 1)·depth. This is the bipolar counterpart of a unipolar envelope output (e.g. SYNESTHESIA's 0..1 follower). All patching is via the card's yellow drill-down PATCH PANEL (top-left / top-right affordances → INPUT / OUTPUT) — no side jacks. DEPTH is MIDI / control-surface assignable (right-click → MIDI Learn) like every other knob. Usage: patch a 0..1 envelope / LFO / sequencer CV through it to get a ±1 modulation source that can both RAISE and LOWER a destination (e.g. drive a filter cutoff above AND below its rest point from a unipolar envelope); pair with DEPOLARIZER for the round trip.

polarizerincvoutcvaudiocvgatepitch

inputs

incvThe UNIPOLAR (0..1) control voltage to polarize. CV-typed (this is CV math). The affine map out = (2·in − 1)·depth is defined for any value — it just linearly centers + scales.

outputs

outcvThe BIPOLAR result: out = (2·in − 1)·depth (in=0 → −depth, in=0.5 → 0, in=1 → +depth). CV-typed.

params

depthlinear0..1(default 1)
source · polarizer.ts
quadralogical utilities

QUADRALOGICAL is a four-input video mixer driven by a single XY joystick. The pad's position (pos_x, pos_y) is mapped over the unit square to four CORNER weights — one per input: in1 top-left, in2 top-right, in3 bottom-left, in4 bottom-right. A bilinear base gives every corner (one input solo) and every edge (a 2-input blend) for free; outside the central yellow DIAMOND the weights are power-sharpened toward a crisp 2-input region, while inside the diamond all four inputs stay balanced (the all-4 composite zone). The model is "logical" because each of the FOUR edges of the joystick cycle (1-2, 2-3, 3-4, 4-1) carries its OWN independently-selectable blend effect (DISSOLVE / ADD / MULTIPLY / WIPE / CHROMA / LUMA / DIFF / IRIS) run on that edge's two adjacent inputs, and the four edge-blends are layered weighted by how active each pair is. Unpatched inputs normal down the chain Eurorack-style (in4 falls to in3 to in2 to in1), so a single source never blends against black. Usage: patch one to four video sources into in1-in4, drag the joystick to a corner for a clean cut to one input, to an edge to crossfade/wipe two of them with that edge's effect, or into the diamond for a four-way composite; set each edge's effect with its FX selector and CV-modulate the joystick or per-edge controls for animated transitions.

quadralogicalin1videoin2videoin3videoin4videopos_xcvpos_ycvdiamond_margincvblend_sharpcvedge1_amountcvedge1_paramcvedge2_amountcvedge2_paramcvedge3_amountcvedge3_paramcvedge4_amountcvedge4_paramcvkeyRcvkeyGcvkeyBcvoutvideopreviewvideoaudiocvgatepitch

inputs

in1videovideo
in2videovideo
in3videovideo
in4videovideo
pos_xcvCV -> pos_x param.
pos_ycvCV -> pos_y param.
diamond_margincvCV -> diamond_margin param.
blend_sharpcvCV -> blend_sharp param.
edge1_amountcvCV -> edge1_amount param.
edge1_paramcvCV -> edge1_param param.
edge2_amountcvCV -> edge2_amount param.
edge2_paramcvCV -> edge2_param param.
edge3_amountcvCV -> edge3_amount param.
edge3_paramcvCV -> edge3_param param.
edge4_amountcvCV -> edge4_amount param.
edge4_paramcvCV -> edge4_param param.
keyRcvCV -> keyR param.
keyGcvCV -> keyG param.
keyBcvCV -> keyB param.

outputs

outvideovideo
previewvideovideo

params

pos_xlinear-1..1
pos_ylinear-1..1
diamond_marginlinear0..1
blend_sharplinear0..8
edge1_fxdiscrete0..7
edge1_amountlinear0..1
edge1_paramlinear0..1
edge2_fxdiscrete0..7
edge2_amountlinear0..1
edge2_paramlinear0..1
edge3_fxdiscrete0..7
edge3_amountlinear0..1
edge3_paramlinear0..1
edge4_fxdiscrete0..7
edge4_amountlinear0..1
edge4_paramlinear0..1
keyRlinear0..1
keyGlinear0..1
keyBlinear0..1
invertdiscrete0..1
freezelinear0..1
source · quadralogical.ts
rasterize utilities

Audio -> video raster mapper. Each video frame paints a fixed run of audio samples (samples/frame, ~800 at 48k/60fps) as voltage-per-pixel into the 1024x768 frame in raster order; a scan cursor drifts + wraps through the frame. Faithful raster mapping (NOT an oscilloscope trace) - a steady tone paints drifting horizontal bands whose spacing tracks the audio frequency vs the line/frame rate. Fully untamed: no limiter, no anti-alias.

rasterizeinaudiocursorcvsamplesPerFramecvgaincvwrapcvthruaudiooutmono-videoaudiocvgatepitch

inputs

inaudioAudio in - the signal rasterized into pixels.
cursorcvCV -> scan-cursor start offset (pixels). Scrubs where the run begins.
samplesPerFramecvCV -> samples painted per frame (1 pixel per sample).
gaincvCV -> linear gain applied to each sample before the luminance map.
wrapcvCV -> wrap mode. >=0.5 = clamp (top-to-bottom repaint sweep); <0.5 = wrap (toroidal drift).

outputs

thruaudioAudio passthrough (unmodified) so RASTERIZE can sit inline on a chain.
outmono-videoMono-video output: the accumulated raster frame as a GL texture. Each video frame paints a run of audio samples (samples/frame) as voltage-per-pixel in raster order; the scan cursor drifts + wraps through the 1024x768 frame. A steady tone paints drifting horizontal bands. Driven by the cross-domain video bridge calling RASTERIZE.drawFrame() each frame.

params

cursorpx0..?(default 0)
samplesPerFramelog16..8000(default 800)
gainlog0..8(default 1)
wrapdiscrete0..1(default 0)
source · rasterize.ts
scaler utilities

SCALER — a tiny 1-in / 1-out signal multiplier (a fixed-gain VCA-without-CV / "gain trim" utility). Model: out = in × AMOUNT, computed sample-accurately by a single Web Audio GainNode (no worklet, no DSP build). Controls — AMOUNT: the single scale-factor knob, range ×0.1 .. ×10 on a LOG taper so unity (1.0) sits at the knob CENTER and the cut/boost is symmetric (left extreme = ×0.1, right extreme = ×10); default 1.0, so a freshly spawned SCALER passes a direct patch through unaltered until you dial it. Below 1.0 it ATTENUATES (down to a tenth), above 1.0 it BOOSTS (up to ten times) — unlike a passive attenuator (which only cuts, 0..1), the SCALER can also amplify. IO — IN: the signal to scale (typed audio so it interops with audio cables directly, and widened to accept the CV family so a CV / gate / pitch source can be scaled too — it is just a multiply, valid for either signal class); OUT: the scaled signal (out = in × amount). OUT is TYPE-TRANSPARENT: its cable type ADOPTS whatever is patched into IN — a CV source makes OUT emit CV, an audio source makes it emit audio (it falls back to audio when nothing is patched). This matters when SCALER feeds a VIDEO module: a CV stays CV through the audio→video bridge so AMOUNT actually scales the modulation, instead of being read as audio (which the bridge envelope-follows and clamps, making the knob do nothing). All patching is via the card's yellow drill-down PATCH PANEL (top-left / top-right affordances → INPUT / OUTPUT) — no side jacks. AMOUNT is MIDI / control-surface assignable (right-click → MIDI Learn) like every other knob. Usage: drop one inline on any audio or CV cable to trim level or boost a quiet source; scale an LFO / envelope / sequencer CV up or down before it modulates a destination; or use it as a simple makeup-gain stage after an effect.

scalerinaudiooutaudioaudiocvgatepitch

inputs

inaudioThe signal to scale (gets multiplied by AMOUNT). Typed audio but widened to accept the CV family (cv / pitch / gate) so a control voltage can be scaled too.

outputs

outaudioThe scaled signal: out = in × amount. TYPE-TRANSPARENT — its cable type adopts whatever is patched into IN (a CV source → a CV out, audio → audio; falls back to audio when nothing is patched), so a scaled CV stays CV through the audio→video bridge and AMOUNT actually scales a video module's modulation.

params

amountlog0.1..10(default 1)
source · scaler.ts
scope utilities

2-channel passthrough oscilloscope. Inputs flow unchanged to outputs while an AnalyserNode samples for display.

scopech1audioch2audiotimeMscvch1Scalecvch1Offsetcvch1Rangecvch2Scalecvch2Offsetcvch2Rangecvmodecvintensitycvch1_outaudioch2_outaudiooutmono-videoaudiocvgatepitch

inputs

ch1audioChannel 1 in.
ch2audioChannel 2 in.
timeMscvCV -> time window (ms across canvas width). Mirrors the Time fader 1:1 — the bridge re-reads the same params record so the on-card and video-out renders converge.
ch1ScalecvCV -> ch1 vertical scale.
ch1OffsetcvCV -> ch1 vertical offset.
ch1RangecvCV -> ch1 range (≥0.5 switches to CV ±5 fullscale; <0.5 keeps audio ±1).
ch2ScalecvCV -> ch2 vertical scale.
ch2OffsetcvCV -> ch2 vertical offset.
ch2RangecvCV -> ch2 range (≥0.5 = CV ±5, <0.5 = audio ±1).
modecvCV -> XY mode toggle. Any signal ≥ 0.5 flips to XY (ch1 horizontal, ch2 vertical); below 0.5 = split (two stacked traces).
intensitycvCV -> intensity param.

outputs

ch1_outaudioChannel 1 passthrough.
ch2_outaudioChannel 2 passthrough.
outmono-videoMono-video output: pixel-equivalent of the on-card 2D scope render — both channels, scale/offset, range, XY/split mode, timeMs window. Driven by the cross-domain video bridge calling SCOPE.drawFrame() each video frame, so every scope control affects what downstream video modules see.

params

timeMsms1..200(default 20)
ch1Scalelog0.1..10(default 1)
ch1Offsetlinear-1..1(default 0)
ch1Rangediscrete0..1(default 0)
ch2Scalelog0.1..10(default 1)
ch2Offsetlinear-1..1(default 0)
ch2Rangediscrete0..1(default 0)
modediscrete0..1(default 0)
intensitylinear0..1(default 0.5)
source · scope.ts
scoreboard utilities

A 4-digit neon 7-segment counter widget, rendered as a digital-alarm-clock face: a zero-padded value (0000-9999) drawn as chamfered hexagonal segments in a hue-tinted glow on soft black (#0a0a0a), with off segments fully invisible (no LCD ghost). It is a pure CV-driven generator with NO video input — a 2D OffscreenCanvas rasterizes the digits via the drawScoreboard helper and uploads them as an RGBA texture; a trivial fragment shader letterboxes that 8:3 source into the 4:3 engine frame, width-locked and centered vertically with pure-black bands top and bottom (and a dark fallback fill before the first paint). Each rising edge on SCORE adds 1 to the counter; it wraps from 9999 back to 0 (a periodic counter, handy for sequencing). RESET zeros it. The COLOR knob sets the lit-segment and glow hue. Patch a clock or sequencer gate into SCORE to count beats/events on screen, and a reset gate to zero it on a bar/loop boundary; the counter always starts at 0 on spawn (it is not persisted).

scoreboardscorecvresetcvoutvideoaudiocvgatepitch

inputs

scorecvCV -> scoreTrig param.
resetcvCV -> resetTrig param.

outputs

outvideovideo

params

colorlinear0..1
scoreTriglinear0..1(default 0)
resetTriglinear0..1(default 0)
source · scoreboard.ts
stereovca utilities

Stereo VCA + ring modulator. Per-channel multiply: out_l = in_l * (strength_l + offset) * level; out_r = in_r * (strength_r + offset) * level. The same math behaves as VCA gain control when strength is slow (CV / LFO / envelope) and as ring modulation when strength is audio-rate — no mode toggle, the perceptual difference emerges from signal content. INDEPENDENT normalling: if in_r is unpatched it copies in_l (mono → stereo); if strength_r is unpatched it copies strength_l (one strength drives both VCAs). The two halves normal independently, so true-stereo audio + mono strength works, as does mono audio + per-side strength. Audio carriers (in_l/in_r) declare cable type `audio`; strength inputs declare `cv` (raw bipolar carrier consumed in the multiply with no scaling — listed in PASSTHROUGH_BY_DESIGN) so any cv source (LFO, ADSR, sequencer step CV) lands without a cross-type cast.

stereovcain_laudioin_raudiostrength_lcvstrength_rcvout_laudioout_raudioaudiocvgatepitch

inputs

in_laudioLeft audio input. Multiplied by (strength_l + offset) * level.
in_raudioRight audio input. Multiplied by (strength_r + offset) * level. Normalled to in_l when unpatched (mono → stereo).
strength_lcvLeft strength / ring carrier. Cable type `cv` so LFOs / ADSRs / sequencer-step CV land natively. Slow CV gives tremolo; an audio-rate signal patched here gives ring modulation (PASSTHROUGH_BY_DESIGN — the worklet treats strength as a raw bipolar carrier, no cv scaling).
strength_rcvRight strength / ring carrier. Normalled to strength_l when unpatched (one strength drives both VCAs).

outputs

out_laudioLeft output: in_l * (strength_l + offset) * level.
out_raudioRight output: in_r * (strength_r + offset) * level.

params

levellinear0..1(default 1)
offsetlinear-1..1(default 0)
source · stereovca.ts

Bipolar CV-shaping utility with three independent channels: a UNITY scaler (input * atten) plus two attenuvert sections (A, B) whose curve knob morphs the response from linear (k=1) to steep exponential (k=3) via y = sign(x) * |x|^k * atten. Sign is preserved across the curve morph so the transform stays bipolar. CV inputs on every atten/curve knob — useful for envelope shaping, LFO sculpting, or driving any modulation through a tunable response curve.

unityscalemathematiku_incvu_atten_cvcva_incva_atten_cvcva_curve_cvcvb_incvb_atten_cvcvb_curve_cvcvu_outcva_outcvb_outcvaudiocvgatepitch

inputs

u_incvUNITY section signal input (cv, bipolar -1..+1).
u_atten_cvcvCV -> UNITY attenuvert knob (linear scale).
a_incvA section signal input (cv, bipolar).
a_atten_cvcvCV -> A attenuvert knob (linear scale).
a_curve_cvcvCV -> A curve morph (linear scale, 0=linear, 1=steep expo).
b_incvB section signal input (cv, bipolar).
b_atten_cvcvCV -> B attenuvert knob (linear scale).
b_curve_cvcvCV -> B curve morph (linear scale).

outputs

u_outcvUNITY output: u_in * unityAtten (bipolar).
a_outcvA output: sign(a_in) * |a_in|^k * aAtten with k = 1 + 2*aCurve.
b_outcvB output: sign(b_in) * |b_in|^k * bAtten with k = 1 + 2*bCurve.

params

unityAttenlinear-1..1(default 1)
aAttenlinear-1..1(default 1)
aCurvelinear0..1(default 0)
bAttenlinear-1..1(default 1)
bCurvelinear0..1(default 0)
source · unityscalemathematik.ts
v-mixer utilities

A 4-channel additive video mixer. Each frame it samples up to four input textures at the same UV and sums them, scaling each by its own amount fader: out = in1*A1 + in2*A2 + in3*A3 + in4*A4, with the final RGB clamped to [0,1] and alpha forced opaque. Unpatched inputs contribute pure black (they read a 1x1 sentinel texture, not the mixer's own output, so there is no feedback loop). Because the sum is linear, it doubles as a crossfader (push A1 up while pulling A2 down for a two-source dissolve) and as a brightness/level control on a single source. Bright sources or amounts summing above 1.0 clip to white per channel. Usage hint: keep the active amounts summing near 1.0 for clean compositing; drive amount1..amount4 from LFOs or envelopes for automated fades and pulses.

v-mixerin1videoin2videoin3videoin4videoamount1cvamount2cvamount3cvamount4cvoutvideoaudiocvgatepitch

inputs

in1videovideo
in2videovideo
in3videovideo
in4videovideo
amount1cvCV -> amount1 param.
amount2cvCV -> amount2 param.
amount3cvCV -> amount3 param.
amount4cvCV -> amount4 param.

outputs

outvideovideo

params

amount1linear0..1
amount2linear0..1
amount3linear0..1
amount4linear0..1
source · mixer.ts
vca utilities

Voltage-controlled amplifier. Multiplies the audio input by base + (cv * cvAmount).

vcaaudioaudiocvcvaudioaudioaudio_invaudioaudiocvgatepitch

inputs

audioaudioAudio input (gets multiplied) / main audio output.
cvcvModulation CV (gain control).

outputs

audioaudioAudio input (gets multiplied) / main audio output.
audio_invaudioSign-inverted audio output: -out (phase-flipped audio). Useful for stereo widening, side-chain feedback prevention, and mid/side processing. Different operation from ADSR.env_inv (which is 1 - env on a unipolar envelope).

params

baselinear?..?
cvAmountlinear?..?
source · vca.ts

output

audio out output

Terminal stereo output. Two mono inputs (L, R) routed to the host AudioContext destination. Optional output-device dropdown via setSinkId (Chromium 110+).

audio outLaudioRaudioaudiocvgatepitch

inputs

LaudioMono L -> host destination L.
RaudioMono R -> host destination R.

params

mastergain0..1(default 0.7)
source · audio-out.ts
b3ntb0x output

A circuit-level NTSC/composite video destroyer. Where the original BENTBOX does one symbolic RGB/YIQ pass, B3NTB0X runs a real four-stage analog pipeline: it ENCODES the incoming picture into a per-column composite VOLTAGE on a 3.58 MHz subcarrier (with sync tip, blanking, colour burst, and active video), runs that voltage through an analog BEND CIRCUIT (AC/DC coupling, gain, bias, soft-clip + diode clamp, plus four circuit-bend taps), DECODES it back to RGB with a quadrature demodulator and recovered sync, then renders it on a curved CRT (beam blur, phosphor grille, scanlines/interlace, bloom, persistence, overscan, barrel). Sync crush, dot-crawl, rainbow swim and rolling all EMERGE from the signal path — they are not cosmetic filters. Patch a video source into IN and it is the chainable, CRT-rendered OUT. Crank Sync Crush + Bias to tear and roll the picture, starve the Burst to kill colour and bring on herringbone, push Drift for swimming rainbow, and use Bend A–D for wavefold/comb/crush/bleed mangling. The preview is a resizable CRT screen (drag the bottom-right handle; default 540x540, min 360x540) that letterboxes at the live engine aspect with the 4:3 active area, overscan and barrel applied inside the shader; right-click for fullscreen / full-frame / present-on-second-display, and a "reduced precision" badge appears if the GPU cannot allocate the float buffers the composite voltage needs.

b3ntb0xinvideoenhance_cvcvbias_cvcvac_dc_cvcvsync_crush_cvcvburst_starve_cvcvchroma_leak_cvcvluma_peak_cvcvbend_a_cvcvbend_b_cvcvbend_c_cvcvbend_d_cvcvfeedback_cvcvtbc_cvcvtube_bloom_cvcvoverscan_cvcvbarrel_cvcvmirror_x_gatecvmirror_y_gatecvoutvideoaudiocvgatepitch

inputs

invideovideo
enhance_cvcvCV -> enhance param.
bias_cvcvCV -> bias param.
ac_dc_cvcvCV -> ac_dc param.
sync_crush_cvcvCV -> sync_crush param.
burst_starve_cvcvCV -> burst_starve param.
chroma_leak_cvcvCV -> chroma_leak param.
luma_peak_cvcvCV -> luma_peak param.
bend_a_cvcvCV -> bend_a param.
bend_b_cvcvCV -> bend_b param.
bend_c_cvcvCV -> bend_c param.
bend_d_cvcvCV -> bend_d param.
feedback_cvcvCV -> feedback param.
tbc_cvcvCV -> tbc param.
tube_bloom_cvcvCV -> tube_bloom param.
overscan_cvcvCV -> overscan param.
barrel_cvcvCV -> barrel param.
mirror_x_gatecvCV -> mirrorXGate param.
mirror_y_gatecvCV -> mirrorYGate param.

outputs

outvideovideo

params

enhancelinear0..1
biaslinear-1..1
ac_dclinear0..1
sync_crushlinear0..2
burst_starvelinear0..1
chroma_leaklinear0..1
luma_peaklinear0..1
bend_alinear-1..1
bend_blinear-1..1
bend_clinear-1..1
bend_dlinear-1..1
feedbacklinear0..1
tbclinear0..1
tube_bloomlinear0..1
overscanlinear0..1
barrellinear0..1
huelinear-1..1
sub_driftlinear0..1
mirrorXdiscrete0..1
mirrorYdiscrete0..1
mirrorXGatelinear0..1
mirrorYGatelinear0..1
freezelinear0..1
source · b3ntb0x.ts
bentbox output

A virtual CRT driven by a hand-bent analog composite line. The patched RGB image is resampled to a 240-line raster, converted to NTSC YIQ, given a modeled chroma-subcarrier phase, run through a triangle wavefolder + soft-clip on the composite "voltage", decoded back to RGB, blended with the previous frame (ping-pong feedback, max-blend trails), then painted through a CRT phosphor pipeline: scanline-gap mask (with odd/even field parity), RGB-triad subpixel mask, luma bloom, and RF grain. The result is timing-domain glitch (sync tearing, hue shimmer, ghosting, solarization) rather than pixel mosh. With nothing patched into IN it shows a dim blue idle field so you can see it is alive. Card layout: a resizable 4:3-letterboxed CRT screen over a 4x3 knob grid (timing / chroma+gain / feedback+destruction rows) plus two MIRROR toggle buttons. The image is always letterboxed at the live engine aspect (4:3 by default) and never stretched; the screen has DOM-only chrome (right-click for fullscreen, full-frame in-app expand, and present-on-second-display); OUT is a chainable video pass-through so you can stack BENTBOX into another video processor.

bentboxinvideohsync_drift_cvcvhsync_loss_cvcvvsync_drift_cvcvchroma_phase_cvcvchroma_instability_cvcvfeedback_gain_cvcvfeedback_delay_cvcvwavefold_cvcvscan_wobble_cvcvbloom_cvcvnoise_cvcvmaster_gain_cvcvmirror_x_gatecvmirror_y_gatecvoutvideoaudiocvgatepitch

inputs

invideovideo
hsync_drift_cvcvCV -> hsync_drift param.
hsync_loss_cvcvCV -> hsync_loss param.
vsync_drift_cvcvCV -> vsync_drift param.
chroma_phase_cvcvCV -> chroma_phase param.
chroma_instability_cvcvCV -> chroma_instability param.
feedback_gain_cvcvCV -> feedback_gain param.
feedback_delay_cvcvCV -> feedback_delay param.
wavefold_cvcvCV -> wavefold param.
scan_wobble_cvcvCV -> scan_wobble param.
bloom_cvcvCV -> bloom param.
noise_cvcvCV -> noise param.
master_gain_cvcvCV -> master_gain param.
mirror_x_gatecvCV -> mirrorXGate param.
mirror_y_gatecvCV -> mirrorYGate param.

outputs

outvideovideo

params

hsync_driftlinear0..1
hsync_losslinear0..1
vsync_driftlinear0..1
scan_wobblelinear0..1
chroma_phaselinear-1..1
chroma_instabilitylinear0..1
feedback_gainlinear0..1
feedback_delaylinear0..1
wavefoldlinear0..1
bloomlinear0..1
noiselinear0..1
master_gainlinear0..2
mirrorXdiscrete0..1
mirrorYdiscrete0..1
mirrorXGatelinear0..1
mirrorYGatelinear0..1
source · bentbox.ts
cv buddy output

Sends a clip lane out to a real Eurorack voice through an ES-9. Hand-patch a lane's pitch / gate / velocity into its inputs and CV Buddy passes them through to CV/gate outputs, which the CV-Buddy↔ES-9 reconciler auto-routes to the ES-9's physical output jacks by slot (first instance → jacks 1-3, second → 4-6) and sets each jack's voltage class (pitch → 1 V/oct, gate → +5 V, velocity → ±5 V). The v/oct rides a plain CV cable (not a pitch/poly cable) so CV Buddy stays a note SINK a lane can drive — the 1 V/octave scaling happens on the ES-9 jack. The id-smallest (owner) instance also generates two transport signals: RUN on jack 7 (a gate held high while the rack transport plays) and CLOCK on jack 8 (a DIN-sync pulse train at a selectable PPQN, phase-locked to TIMELORDE) — patch RUN + CLOCK into a Pam's New Workout to slave it to the rack. A third+ CV Buddy sits inert (no free ES-9 jacks). No audio output, so it never appears as a mixer send; with no ES-9 in the rack it is idle and harmless.

cv buddygategatepitchcvvelocitycvpitchCvcvgategatevelCvcvrungateclockgateaudiocvgatepitch

inputs

gategateGate signal (rising/falling edge).
pitchcvControl voltage.
velocitycvControl voltage.

outputs

pitchCvcvControl voltage.
gategateGate signal (rising/falling edge).
velCvcvControl voltage.
rungateGate signal (rising/falling edge).
clockgateGate signal (rising/falling edge).

params

clockOffsetMsms-20..20(default 0)
source · cv-buddy.ts

The two-jack CV BUDDY: pitch and gate only, no velocity. The full CV Buddy spends THREE of the ES-9's eight outputs per voice, so two of them fill the device; a mini spends two. That buys the two layouts that matter — THREE minis fit in outputs 1-6 and leave jacks 7 and 8 doing RUN and CLOCK (three voices and still a clock for Pam's), or a SINGLE mini takes 1, 2, 7 and 8 and leaves four outputs free for audio sends and returns. Hand-patch a clip lane's pitch and gate into its inputs; the CV-Buddy↔ES-9 reconciler auto-routes them to physical jacks and sets each jack's voltage class (pitch → 1 V/oct, gate → +5 V). Slots are shared with any full CV BUDDYs on the rack — both kinds draw from ONE pool in node-id order, so they can never claim the same physical jack. The id-smallest instance of either kind owns RUN (jack 7, held high while the transport plays) and CLOCK (jack 8, a DIN-sync pulse train at a selectable PPQN locked to TIMELORDE). An instance that does not fit in the remaining outputs sits inert and says so. No audio output, so it never appears as a mixer send; with no ES-9 in the rack it is idle and harmless.

cv buddy minigategatepitchcvpitchCvcvgategaterungateclockgateaudiocvgatepitch

inputs

gategateGate signal (rising/falling edge).
pitchcvControl voltage.

outputs

pitchCvcvControl voltage.
gategateGate signal (rising/falling edge).
rungateGate signal (rising/falling edge).
clockgateGate signal (rising/falling edge).

params

clockOffsetMsms-20..20(default 0)
source · cv-buddy-mini.ts
graphic eq output

A full-screen Winamp-style graphic-EQ / VU-meter video output. Patch a STEREO signal into the L and R audio inputs and GRAPHIC EQ analyses each channel with an FFT, folds it into 8 log-spaced frequency bands (roughly 40 Hz up to 16 kHz, an octave-ish per band), and draws each band as a vertical level meter that rises and falls with the music. A green→yellow→red colour ramp climbs each meter (rotate the whole palette with Hue), and a peak-hold cap floats above each bar and falls back at a rate set by Peak. Two switches shape the look: STYLE toggles between SOLID BARS (one smooth filled bar per band) and STACKED BOXES (the classic LED-ladder of discrete segments); DISPLAY toggles between MONO (8 meters across the full width, the L/R average) and STEREO (the screen splits down the middle — the LEFT channel's 8 meters fill the left half, the RIGHT channel's fill the right half). Gain sets sensitivity. With nothing patched the meter frame still draws dim so the card is never black. The render feeds the chainable video out and the on-card preview; hide the controls to use the card as a resizable full-screen monitor.

graphic eqaudio_laudioaudio_raudiooutvideoaudiocvgatepitch

inputs

audio_laudioAudio signal.
audio_raudioAudio signal.

outputs

outvideovideo

params

stylediscrete0..1
displaydiscrete0..1
gainlinear0.5..4
peaklinear0.5..0.99
huelinear0..1
source · graphicEq.ts

MIDI CV BUDDY OUT — the output complement of MIDI-CV-BUDDY. Turns the rack's gate / pitch / velocity CV into MIDI notes sent to an external MIDI device, so a sequencer, envelope, or LFO inside the patch can play a hardware synth. A gate rising edge sends NoteOn [0x90|(ch-1), note, vel]; the falling edge sends NoteOff [0x80|(ch-1), note, 0]. The pitch input (V/oct, 0V = C4 = MIDI 60) is quantized to the nearest semitone for the note number, and the velocity input (0..1 CV) maps to MIDI velocity 1..127 — both are sampled at the gate rising edge. The module TRACKS the currently-sounding note so the NoteOff matches the note that was turned on even if pitch drifts while the gate is held. Pick the output device from a dropdown (enumerated from MIDIAccess.outputs; persisted by device name across saves) and the MIDI channel 1..16. Uses the browser's built-in Web MIDI output (no companion app); the user clicks "Connect MIDI…" once per origin to grant access. Device hot-plug is handled, and an all-notes-off plus a matched NoteOff are sent on dispose / device-change / channel-change so external gear is never left with a stuck note. CV is read main-thread via AnalyserNode taps polled on the shared scheduler clock — no AudioWorklet. Terminal MIDI sink (no audio outputs).

midi cv buddy outpolypolyPitchGategategatepitchcvvelocitycvaudiocvgatepitch

inputs

polypolyPitchGatepolyPitchGate
gategateGate input. Rising edge → MIDI NoteOn (note = quantized pitch input, velocity = velocity input) on the selected device + channel. Falling edge → NoteOff of the note that was turned on.
pitchcvV/oct pitch input (0V = C4 = MIDI 60), quantized to the nearest semitone for the outgoing MIDI note number. Sampled at the gate rising edge; the held NoteOff targets that note even if pitch drifts under a held gate.
velocitycvVelocity CV input (0..1) mapped to MIDI velocity 1..127 (floored to 1 so a NoteOn never collapses into a velocity-0 NoteOff). Sampled at the gate rising edge.
source · midi-out-buddy.ts
monoglitch output

MONOGLITCH is a luma-driven scanline-displacement glitch effect that doubles as a chainable video OUTPUT. It quantizes the incoming video into a stack of horizontal scanlines (Lines count) and, per line, samples the source luminance at the row center and lifts that line's vertical position upward by luma x Z, so bright pixels bow the lines up while dark areas leave them flat. Each line is rendered as a thin tinted band whose thickness is set by Gap and whose color comes from the R/G/B tint (default a green-phosphor look); the source luminance also gives bright bands a subtle brightness bonus (band color scales by 0.4 + luma x 0.8). H Ramp and V Ramp pan the sampled image horizontally/vertically and wrap at the edges, so feeding them saw LFOs scrolls the whole field. Despite the historical RUTTETRA name it is NOT a true Rutt/Etra raster remap (see reshaper/ruttetra for that) - it is a stylized oscilloscope/CRT-glitch aesthetic. Patch a video source into IN, dial Lines and Z for the scan density and warp, tint to taste, then take OUT into another video module or to screen. With nothing patched it shows a dark-navy idle sweep. There is a live preview screen with the picture, and two switches beside it that do opposite things: SCREEN turns the preview off to reclaim its space (the module goes on rendering either way), and MONITOR hides the control bands so the picture has the whole plate to itself - drag the bottom-right corner to size it, and click MONITOR again to bring the controls back. Either way it is a viewport only; neither changes the output resolution.

monoglitchinvideohRampcvvRampcvintensitycvoutvideoaudiocvgatepitch

inputs

invideovideo
hRampcvCV -> hRamp param.
vRampcvCV -> vRamp param.
intensitycvCV -> intensity param.

outputs

outvideovideo

params

hRamplinear-1..1
vRamplinear-1..1
intensitylinear0..1
lineslinear8..240
spacinglinear0..0.95
tintRlinear0..1
tintGlinear0..1
tintBlinear0..1
source · monoglitch.ts

OUT TO LAUNCH — turns a Novation Launchpad Mini Mk3 into a live 9×9 RGB VIDEO MONITOR. Takes ONE video input, downsamples it to a 9×9 grid on the GPU (each cell is a TAPS×TAPS box-average of its slice of the frame, so it does not alias/flicker on moving video), and pushes those 81 pixels to a BOUND Launchpad's LEDs in real time via the batch-RGB SysEx. The Mini Mk3's WHOLE addressable surface IS a 9×9 grid — the 8×8 pads (11..88) + the top CC row (91..98) + the right scene column (19..89) + the corner logo (99) — and in programmer-mode numbering every button is row*10+col for row/col 1..9, so the downsample maps DIRECTLY onto the hardware, UPRIGHT: the bottom-left of the frame lands on pad 11 (bottom-left), the top-right on the logo (99). It has NO video output — it is a SINK, an endpoint (like a monitor at the end of a chain, except the monitor is a grid of buttons). BIND from the card: Connect (gesture-gated Web-MIDI sysex, no eager prompt) then pick a Launchpad output; bindMonitor claims EXCLUSIVE LED control of that device (it enters programmer mode + its LEDs are driven by the video), so a bound Launchpad CANNOT be used for control at the same time — out to launch takes it over. Two knobs shape the look: BRIGHT (0..1) scales overall LED brightness; GAMMA (0.5..3, default 2.2) deepens/lifts the mid-tones (both applied identically to the LEDs AND the on-card preview, so the preview matches the hardware exactly). Architecture: the module's pure-GL factory box-averages the input into a tiny 9×9 FBO and readPixels the 81 RGBA texels each frame (exposed via read('grid9x9')); the CARD's throttled ~30 fps rAF loop reads that grid, draws the 9×9 preview, maps it to LED colours (monitorGridToLeds), and setMonitorFrame()s it (diffed → only changed LEDs sent, batched into one SysEx ≈413 bytes/frame — trivial over USB-MIDI). pullExempt keeps the readback fresh even when the card is off-screen. The monitor binding is INDEPENDENT of the clip-launcher's L/R units, so out to launch on one Launchpad and LAUNCHPAD CONTROL on another run simultaneously (one owner per physical device; same-device sharing is refused via isOutputClaimed). On unbind / node-delete the device is released (LEDs cleared, returned to Live mode). USAGE: patch a source (CAMERA / a generator / a clip) → VIDEO in, Connect + pick your Launchpad, and dial BRIGHT/GAMMA — a tiny confidence monitor, a lo-fi VJ output, or lighting a Launchpad from a live feed. The pure surface mapping (lpMonitorIndex / rgb8ToLp / monitorGridToLeds) lives in $lib/control/launchpad/launchpad-sysex.

out to launchinvideoaudiocvgatepitch

inputs

invideovideo

params

brightlinear0..1
gammalinear0.5..3
source · out-to-launch.ts
output output

output is the screen sink of the video chain — the card body itself is the live picture. Whatever video signal you patch into it is copied frame-by-frame into this card's own framebuffer (FBO) and blitted onto the visible canvas, aspect-fit (the engine render is letterboxed into the card; the engine is 4:3 by default). The shader is a plain texture copy: with a signal patched it shows the input verbatim; with nothing patched it draws a static idle pattern — a dark navy field with a subtle vertical brightness gradient (the blue channel rises toward one edge) — so you can tell the card is alive while you drag a cable in. The pattern does not animate; there is no time uniform, so it's a fixed gradient, not a moving sweep. Each output card pulls its OWN input via engine.blitOutputToDrawingBuffer(nodeId) (multiple outputs in a rack each show their own feed, no last-one-wins coupling). Use it as the monitor/projector at the end of a video patch — or mid-chain, since it passes its input straight through. In the rack it is a compact tile showing a live thumbnail of its own feed; the tile itself is not resizable. To see the picture bigger, right-click it: DETACH DISPLAY floats the output free of the rack as its own window — resizable by its bottom-right corner, draggable by its title bar, carrying no patch jacks or cables — and RE-ATTACH puts it back. The floating window is owned by the module, so deleting the module removes it and deleting the floating window removes the module. Its size and position live in node.data and sync to collaborators via Y.Doc. Expand the module to its faceplate for the same picture plus the display menu: true fullscreen, in-app full frame, detach, or present-on-a-second-display; right-clicking the picture anywhere opens that menu too. DELETING an output that sits mid-chain, with both its input and its output patched, re-joins the module feeding it directly to whatever it was feeding — so pulling a monitor out of a chain leaves the chain intact rather than cut in two. An output patched to itself is the one shape that cannot be re-joined, and it is deleted plainly.

outputinvideooutvideoaudiocvgatepitch

inputs

invideovideo

outputs

outvideovideo
source · video-out.ts
ptz cam output

CV control of a physical PTZ camera (NexiGo P610, Logitech PTZ Pro 2) — pan/tilt/zoom knobs plus matching CV inputs, sent as MIDI sysex to the native PT-PTZ helper (tools/pt-ptz), which drives the cameras over USB (one MIDI pair and one module per camera). Each axis follows the mode the camera reports in the bind handshake: absolute axes take normalized positions, velocity axes take signed rates with a watchdog-guarded stop; sends are coalesced to ~10 Hz. Carries no audio or video — the camera picture arrives through a normal camera input.

ptz campan_cvcvtilt_cvcvzoom_cvcvaudiocvgatepitch

inputs

pan_cvcvControl voltage.
tilt_cvcvControl voltage.
zoom_cvcvControl voltage.

params

panlinear-1..1(default 0)
tiltlinear-1..1(default 0)
zoomlinear0..1(default 0)
slewlinear0..1(default 0.3)
source · ptzcam.ts

Video + audio RECORDER sink. Patch a picture into IN and a stereo soundtrack into A·L / A·R, type a filename, hit RECORD, and RECORDERBOX captures it to a HIGH-QUALITY, CRASH-RECOVERABLE H.264 MP4. Model: like OUTPUT, it monitors its video input (live preview + an OUT pass-through so you can chain it inline) while ALSO recording. Encoding runs through WebCodecs (H.264 video at ~14 Mbps VBR, AAC stereo audio) muxed by Mediabunny (MPL-2.0) into a FRAGMENTED MP4 (fastStart:"fragmented") streamed to OPFS scratch via a dedicated Worker holding a FileSystemSyncAccessHandle — the only browser API that writes real disk synchronously AND survives a tab crash. The OPFS scratch is named after your sanitized filename + a .partial marker + the start epoch, so the partial carries your intended name. Controls: an editable FILE field (node.data.filename, synced to rack-mates), a SIZE / quality selector (HIGH / BALANCED / SMALL), and a RECORD ON/OFF toggle. The SIZE selector trades file size against quality: HIGH is the original ~14 Mbps H.264 (the DEFAULT — no change for existing racks); BALANCED and SMALL PREFER a more efficient modern codec (AV1, then VP9, capability-probed at the actual recording resolution via VideoEncoder.isConfigSupported) at a lower bitrate, longer keyframe interval, and lower audio bitrate, falling back to a lower-bitrate H.264 where no modern codec encodes. The codec stays inside the same fragmented MP4 container, so the extension (.mp4) and crash-recovery semantics never change — only the bytes inside get smaller. SMALL is typically ~70-80% smaller than HIGH; BALANCED ~55-65% smaller, both at near-imperceptible quality cost on synth/visualizer output. The chosen tier syncs to rack-mates (node.data.quality) and is locked while a take is in progress. NO "SAVE AS" PROMPT (folder model): on Chromium, pressing RECORD picks a destination FOLDER ONCE via showDirectoryPicker (a valid user gesture); thereafter the recording auto-writes into that folder using the FILE box directly — no per-save dialog — and the folder is remembered so the next record needs no prompt at all. The ONLY remaining prompt is an OVERWRITE confirm when a file with the target name already exists (cancelling the folder picker, or declining the overwrite, does NOT start recording). The chosen FileSystemDirectoryHandle is persisted into the recovery manifest. On STOP the finished MP4 is remuxed to a flat (NLE-importable) container and STREAMED into the folder (never read whole into memory — a long 4K take can be GBs). Firefox/Safari (no directory picker) record to OPFS and download each file via <a download> with the correct name. GOPRO CHUNKING: a long take rolls to a NEW file every ~10 min with a 5-SECOND AUDIO OVERLAP (the last 5 s of chunk N is duplicated as the start of chunk N+1), named FILENAME-CHUNK#-DATETIME.mp4 (RECORDING-001-…, RECORDING-002-…) — unique + Finder-sortable; a take under ~10 min is a single RECORDING-001-<datetime>.mp4. CONSTANT FRAME RATE: video frames are encoded on an even index/fps PTS grid (not jittery wall-clock time), which fixes the macOS Preview/QuickTime "slow-motion" artifact that an irregular variable-rate PTS stream produced. Inputs: in (video, polymorphic), audio_l + audio_r (audio — a NEW cross-domain audio→video audio-input bridge connects each upstream audio source straight into a MediaStreamAudioDestinationNode this module owns; the audio is TAP-ONLY and is NOT monitored through your speakers). Output: out (video pass-through of in). CRASH RECOVERY: because the file is fragmented and each fragment is flushed to disk, a take is playable from whatever reached disk even if the tab dies before you press STOP — on mount the card scans an IndexedDB manifest for any in-flight recording and offers "Recover unsaved recording?" with Save / Discard. If the destination FOLDER was persisted, Save re-requests write permission and streams the partial straight back into it under the chunk's FILENAME-CHUNK#-DATETIME name (no re-picking); if the handle is gone or permission is denied it falls back to a picker/download suggesting the right filename. Recovery is THIS-MACHINE/BROWSER ONLY (OPFS is origin-local and does NOT sync to collaborators). Defaults: 30 fps, ~14 Mbps; locked but overridable later. Graceful degrade: where the runtime has no OS H.264 encoder (headless CI, some platforms) the RECORD button is disabled with a clear "no H.264 encoder available" badge — it never crashes.

recorderboxinvideoaudio_laudioaudio_raudiooutvideoaudiocvgatepitch

inputs

invideoThe picture to record + monitor. Polymorphic video input (video / mono-video / image upcast), like OUTPUT.in.
audio_laudioLeft channel of the soundtrack to record. Cross-domain audio→video audio-input: the source is connected straight into a MediaStreamAudioDestinationNode this module owns. TAP-ONLY — NOT monitored through the speakers.
audio_raudioRight channel of the soundtrack to record (same cross-domain audio-input bridge as audio_l).

outputs

outvideoPass-through of the IN video (input → FBO → out), so RECORDERBOX can be chained inline without breaking the signal flow.
source · recorderbox.ts
reshaper output

RESHAPER is a coordinate-remap video processor that emulates a CRT raster scan whose horizontal and vertical sweeps are patchable instead of fixed. For every output pixel it reads a horizontal coordinate from the X field and a vertical coordinate from the Y field (the red channel of each mono-video texture), then samples the Z source video at that remapped position. With X and Y unpatched it falls back to identity ramps (screen-u, screen-v), so Z passes straight through like a normal display. Feed X/Y from shaped ramps (e.g. SHAPEDRAMPS folds, triangles, or radial fields) and the source video is rebuilt inside that deformed coordinate space — folded, mirrored, or circularised. On top of the field remap, the source's own brightness at each screen pixel pushes the lookup: luma above mid-grey lifts, below pushes back, scaled by X Disp / Y Disp — the classic Rutt/Etra "raised terrain" displacement. The final color is multiplied by Intensity and the R/G/B tint. Usage: patch a video into Z for a quick scanline display; drive X and/or Y from a ramp generator to warp it, or just dial X Disp / Y Disp for a luma-relief effect from Z alone. Output is a standard video texture, so chain it downstream (e.g. LINES into RESHAPER into MONOGLITCH). There is a live preview screen showing the remapped output, and two switches beside it that do opposite things: SCREEN turns the preview off to reclaim its space (the module goes on rendering either way), and MONITOR hides the control bands so the picture has the whole plate to itself - drag the bottom-right corner to size it, and click MONITOR again to bring the controls back. Either way it is a viewport only; neither changes the output resolution.

reshaperxmono-videoymono-videozvideointensitycvxDispcvyDispcvoutvideoaudiocvgatepitch

inputs

xmono-videomono-video
ymono-videomono-video
zvideovideo
intensitycvCV -> intensity param.
xDispcvCV -> xDisp param.
yDispcvCV -> yDisp param.

outputs

outvideovideo

params

intensitylinear0..2
xDisplinear-1..1
yDisplinear-1..1
tintRlinear0..1
tintGlinear0..1
tintBlinear0..1
source · reshaper.ts
tempest output

TEMPEST (P1) — a Tempest-style vector-tube shooter as a video SOURCE. This phase renders the glowing additive-line "well" (the QuadraScan vector look): a bright near rim ring, a dim far pit ring, and radial lane lines, with the player CLAW riding the near rim. The CV input `rim` (0..1, wraps) drives the claw's position around the rim — the authentic rotary-spinner control, e.g. a gamepad joystick axis — and the SHAPE param picks the tube cross-section (circle / square / star). Every line segment is expanded on the CPU into a glowing quad (1px gl.LINES clamp to a dim, dotted stipple on the real GPU), so the web reads solid + luminous at any orientation. `out` is a normal downstream video texture. Enemies, fire, scoring, the audio-breathing tube and the video-textured surface land in later phases; the pure geometry/projection core lives in tempest-core.ts.

tempestrimcvoutvideoaudiocvgatepitch

inputs

rimcvCV -> rim param.

outputs

outvideovideo

params

rimlinear0..1
shapediscrete0..?
source · tempest.ts
xyz output

An authentic forward-scatter Rutt/Etra scan-processor. A 320x180 grid of sample points walks the Z source; for each point it reads the source luma, places it along an internally-generated H/V ramp, then displaces that position by (luma - 0.5) so bright pixels push their scanline outward and dark pixels recede - building a 3D heightmap relief out of the picture. Adjacent grid points within each row are joined into horizontal LINE segments, and the whole raster is drawn with additive (phosphor) blending over a black field, exactly like a CRT scope. With everything at default the ramp is a linear 1:1 mapping and Y Disp = -0.3, so the source is read upright and bright areas raise the terrain - the classic Rutt/Etra "raised landscape" look. Patch any video, image, or keyer into Z; sweep Y Disp (and X Disp) for relief depth, raise Intensity for a brighter glow, morph the X/Y Shape ramps toward triangle/soft/radial for warped scan geometry, and modulate the params with CV for animated topography. Z left unpatched binds a mid-grey sentinel (luma 0.5 = zero displacement), so the card shows flat scanlines rather than a black void. There is a live preview screen with the picture, and two switches beside it that do opposite things: SCREEN turns the preview off to reclaim its space (the module goes on rendering either way), and MONITOR hides the control bands so the picture has the whole plate to itself - drag the bottom-right corner to size it, and click MONITOR again to bring the controls back. Either way it is a viewport only; neither changes the output resolution.

xyzzvideoxShapecvyShapecvxDispcvyDispcvintensitycvxFreqcvyFreqcvoutvideoaudiocvgatepitch

inputs

zvideovideo
xShapecvCV -> xShape param.
yShapecvCV -> yShape param.
xDispcvCV -> xDisp param.
yDispcvCV -> yDisp param.
intensitycvCV -> intensity param.
xFreqcvCV -> xFreq param.
yFreqcvCV -> yFreq param.

outputs

outvideovideo

params

xShapelinear0..1
yShapelinear0..1
xDisplinear-1..1
yDisplinear-1..1
intensitylinear0..2
tintRlinear0..1
tintGlinear0..1
tintBlinear0..1
xFreqlinear0.25..8
yFreqlinear0.25..8
xPhaselinear0..1
yPhaselinear0..1
source · ruttetra.ts

utility

4plexer utility

4-in / 4-out discrete signal router for audio AND cv (they share the Web Audio substrate, so either cable type patches in and routes identically). Four signal inputs (in1..in4) and four signal outputs (out1..out4); each output has its own selector knob (sel1..sel4, shown 1..4 on the card) choosing which ONE of the four inputs that output carries — discrete, never a blend or in-between, with a ~4 ms declick crossfade on the switch so audio-rate inputs don't click. Each output also has its own GATE input (gate1..gate4): every rising edge advances that output's selector to the next input (1→2→3→4→1, wrapping). The four outputs are fully independent — different selections, different gate streams. Knobs are directly settable in the UI (click/drag to a position) and the selection persists in node params (synced + saved); a gate-advance posts the new index back so it persists exactly like a manual click. Defaults are a straight pass-through (out1=in1, out2=in2, out3=in3, out4=in4).

4plexerin1cvin2cvin3cvin4cvgate1gategate2gategate3gategate4gateout1cvout2cvout3cvout4cvaudiocvgatepitch

inputs

in1cvSignal input 1 (audio or cv — routes identically).
in2cvSignal input 2 (audio or cv).
in3cvSignal input 3 (audio or cv).
in4cvSignal input 4 (audio or cv).
gate1gateRising edge advances OUT 1's selector (1→2→3→4→1).
gate2gateRising edge advances OUT 2's selector.
gate3gateRising edge advances OUT 3's selector.
gate4gateRising edge advances OUT 4's selector.

outputs

out1cvCarries the input selected by sel1 (discrete).
out2cvCarries the input selected by sel2 (discrete).
out3cvCarries the input selected by sel3 (discrete).
out4cvCarries the input selected by sel4 (discrete).
source · fourplexer.ts
956 ribbon utility

956 Ribbon Controller (moogafakkin System 55 clone — categorized under Ports -> moogafakkin). A horizontal touch-ribbon: press and slide along the strip and the position maps to a continuous pitch CV, with a GATE that goes HIGH while touched. Outputs pitch (V/oct: 1.0 = one octave, a semitone = 1/12, matching MIDI CV BUDDY) and gate. Like the hardware resistive ribbon, lifting off HOLDS the last pitch — only the gate falls, so the patched VCO stays at the last played note. SCALE sets the ribbon span in octaves (0..5, default 2); OFFSET shifts the base pitch in octaves (-2..2). A UI-driven CV source in the JOYSTICK / GAMEPAD family — the card pointer drives two ConstantSourceNodes; no audio worklet. Beige moogafakkin faceplate. The on-screen keyboards (950/951/952) are intentionally NOT cloned — route hardware MIDI keys through MIDI CV BUDDY instead.

956 ribbonpitchpitchgategateaudiocvgatepitch

outputs

pitchpitchV/oct pitch CV.
gategateGate signal (rising/falling edge).

params

poslinear0..1(default 0)
gatelinear0..1(default 0)
scalelinear0..5(default 2)
offsetlinear-2..2(default 0)
source · moog956.ts
gamepad utility

Connected USB / Bluetooth game controller as CV (stick axes + triggers) and gate (face / bumper / dpad / menu buttons). Reads navigator.getGamepads() at requestAnimationFrame rate. Browser security requires the user to press a button on the gamepad once before the browser exposes it. Outputs: lx / ly / rx / ry (cv ±1, Y inverted so +1 = up, 0.08 deadzone), ax / ay (cv ±1 — the AUX stick, a third X/Y pair that ships bound to NOTHING and reads a hard 0 until you bind it, for the axes a flight stick has and a gamepad does not: a twist/rudder, a throttle lever, a slider), lt / rt (cv 0..1), lb / rb / a / b / x / y / du / dd / dl / dr / start / back (gate). Standard mapping = Xbox layout; PlayStation + generic HID controllers that report 'standard' mapping also work. SLOT param picks which of up to 4 simultaneous controllers to read; it is the module's only param, and it is the one ranked cell on the faceplate — everything else a player configures lives on the dock's MAPPING BOARD. REMAP: right-click ANY cell on the board — a button LED, a trigger row, or an X / Y button under a stick — to arm a listener, then move the physical control you want bound to that output; alt-click resets a cell. (The axis buttons used to arm on LEFT-click and RESET on right-click, the inverse of every other cell, so right-clicking the one you wanted to bind silently cleared it instead of listening.) The Gamepad API has no events, so the armed listener diffs each poll against the reading captured when you armed it and takes the first control past a 0.5 threshold; Escape cancels. STICK CALIBRATION, on BOTH sticks independently: "calibrate left/right" arms a sweep mode — move that stick through its full range several times (the board draws the swept extent as a box inside the stick pad, which fills as you go), then "complete" locks the swept range in so observed-min→full-min and observed-max→full-max per axis, with a captured true rest centre mapped to 0 and a radial deadzone around it (no snap-back drift). A separate per-stick "set center" captures that rest centre on its own, for a stick that physically rests off-centre. INVERT: a per-axis sign flip on every stick axis (lx / ly / rx / ry / ax / ay) that composes on top of any remap. Each of these is persisted once to the patch (rides collab + undo); "clear" reverts a stick to the fixed-deadzone path. SAVE / LOAD MAPPING bundles every binding, both calibrations and every invert into a .json you can reload or share, and built-in presets ship for the NXT Gladiator and for the Gladiator EVO R (whose TWIST is physical axis 5, a full-range bipolar axis, routed to the AUX X output). Presets are OFFERED in the picker and never auto-applied on a device-id match. This is what makes worn pads and non-Xbox-layout sticks (e.g. VKB Gladiator NXT flight sticks, which report a non-standard mapping with a reduced raw range) reach the full ±1 output range.

gamepadlxcvlycvrxcvrycvaxcvaycvltcvrtcvlbgaterbgateagatebgatexgateygatedugateddgatedlgatedrgatestartgatebackgateaudiocvgatepitch

outputs

lxcvControl voltage.
lycvControl voltage.
rxcvControl voltage.
rycvControl voltage.
axcvControl voltage.
aycvControl voltage.
ltcvControl voltage.
rtcvControl voltage.
lbgateGate signal (rising/falling edge).
rbgateGate signal (rising/falling edge).
agateGate signal (rising/falling edge).
bgateGate signal (rising/falling edge).
xgateGate signal (rising/falling edge).
ygateGate signal (rising/falling edge).
dugateGate signal (rising/falling edge).
ddgateGate signal (rising/falling edge).
dlgateGate signal (rising/falling edge).
drgateGate signal (rising/falling edge).
startgateGate signal (rising/falling edge).
backgateGate signal (rising/falling edge).
source · gamepad.ts
gatemaiden utility

Single-input gate↔trigger converter — the convenience utility for the trigger/gate model (think Doepfer A-162 / Make Noise Maths EOR-EOC in one small module). ONE generic CV input (IN) accepts EITHER a gate or a trigger, and produces BOTH a GATE output and a TRIG output, derived from the input's level + rising edges (no mode switch — like Maths, it always emits both). GATE out is a held square that stays high while the input is high, with a MINIMUM width of the Len knob (0.005–2 s, default 50 ms): so a long gate passes through duration-matched, while a short TRIGGER in is widened into a clean usable gate (trigger→gate). TRIG out fires a short pulse on EVERY rising edge of the input: so a GATE in yields one trigger per gate START (gate→trigger), and a TRIGGER in is effectively reshaped through (one pulse per input pulse). The Shape button picks the emitted trigger waveform — △ triangle (default, a 5 ms ramp-up/ramp-down strike) or ▭ square. In the trigger/gate model: ▷ marks the trigger output, ▭ the gate ports. Why you want it: anything that must START an event should be a trigger (edge-fired once), anything that must SUSTAIN should be a gate (level-held); GATEMAIDEN lets you convert freely between the two when you cross-patch — e.g. take a sequencer's held step-gate and get a clean clock trigger out of its starts, or take a drum trigger and open an ADSR's sustain with a real gate. Sample-accurate DSP (pure core in packages/dsp/src/lib/gatemaiden-dsp.ts), so it single-fires by construction.

gatemaideningategategatetriggateaudiocvgatepitch

inputs

ingateGate signal (rising/falling edge).

outputs

gategateGate signal (rising/falling edge).
triggateGate signal (rising/falling edge).

params

gateLens?..?(default 0.05)
trigShapediscrete0..1(default 0)
source · gatemaiden.ts
joystick utility

Manual XY controller emitting four bipolar CV outputs. Drag a virtual stick inside a square pad: center = (0, 0), the corners reach (±1, ±1). Outputs the raw X and Y plus their inversions (nx = −x, ny = −y) so you can drive quadrature or mirrored modulation from one hand without copying and inverting downstream. The card snaps back to center on pointer-up; at the audio layer the module is pure — whatever the position params say is what comes out (four ConstantSourceNodes).

joystickxcvycvnxcvnycvaudiocvgatepitch

outputs

xcvControl voltage.
ycvControl voltage.
nxcvControl voltage.
nycvControl voltage.

params

pos_xlinear-1..1(default 0)
pos_ylinear-1..1(default 0)
source · joystick.ts

Sample & hold combined with a musical scale quantizer. On a RISING EDGE at gate_in the module samples cv_in and HOLDS it on cv_out until the next rising edge; cv_quant is that held value snapped to the nearest note of the selected SCALE (1V/oct, root = C / 0V, 12 equal-tempered semitones per octave, 1/12 V per semitone). When NOTHING is patched to gate_in, cv_in passes through CONTINUOUSLY and cv_quant continuously quantizes the live input — so the module becomes a pure QUANTIZER (the gate-connected state is detected at the graph level, mirroring SEQUENCER/SCORE external-clock-vs-internal-BPM and SKIFREE's unpatched-input fallback). The SCALE knob picks the quantize scale from Chromatic, Major, Minor, Dorian, Phrygian, Lydian, Mixolydian, Locrian, Harmonic Minor, Melodic Minor; the current scale NAME is displayed above the knob and updates reactively (knob / CV / MIDI Learn). The latch + nearest-note quantizer are pure functions (packages/dsp/src/lib/sample-hold-dsp.ts) shared verbatim by the worklet, the unit tests, and node-ART. Classic uses: quantize a slow LFO/random voltage into stepped melodies, sample noise on a clock for stepped random pitches, or strip the gate to use it as an inline quantizer in front of a VCO's pitch input.

sample & holdcv_incvgate_ingatecv_outcvcv_quantcvaudiocvgatepitch

inputs

cv_incvThe value to sample / quantize (1V/oct for pitch).
gate_ingateGate / clock. A rising edge latches cv_in onto cv_out. UNPATCHED → cv_in passes through continuously and the module becomes a pure quantizer.

outputs

cv_outcvThe held value (or, when gate_in is unpatched, the live passed-through cv_in).
cv_quantcvcv_out snapped to the nearest note of the selected scale (1V/oct, root = C / 0V).

params

scalediscrete0..?(default 1)
source · sample-hold.ts
slewswitch utility

Quad slew limiter combined with a 4→1 sequential CV switch. Four CV inputs each pass through an independent slew limiter (per-channel time constant 1 ms–5 s, CV-controllable) for portamento / smoothing, available on out1–out4. A step_clock gate advances a sequential switch that selects among the (slewed) channels and presents the result on `switched`, with a LENGTH (1–4) and MODE control, a crossfade time between selections, a reset gate, a step_idx CV, and an end-of-cycle (eoc) gate. One of the three ATLANTIS-PATCH support modules; broadly useful as a general CV smoother + router.

slewswitchin1cvin2cvin3cvin4cvstep_clockgateresetgateslew1_cvcvslew2_cvcvslew3_cvcvslew4_cvcvout1cvout2cvout3cvout4cvswitchedcvstep_idxcveocgateaudiocvgatepitch

inputs

in1cvControl voltage.
in2cvControl voltage.
in3cvControl voltage.
in4cvControl voltage.
step_clockgateGate signal (rising/falling edge).
resetgateGate signal (rising/falling edge).
slew1_cvcvCV -> slew1 param.
slew2_cvcvCV -> slew2 param.
slew3_cvcvCV -> slew3 param.
slew4_cvcvCV -> slew4 param.

outputs

out1cvControl voltage.
out2cvControl voltage.
out3cvControl voltage.
out4cvControl voltage.
switchedcvControl voltage.
step_idxcvControl voltage.
eocgateGate signal (rising/falling edge).

params

slew1s0.001..5(default 0.5)
slew2s0.001..5(default 0.5)
slew3s0.001..5(default 0.5)
slew4s0.001..5(default 0.5)
modediscrete0..2(default 0)
lengthdiscrete1..4(default 4)
xfadeTimes0.001..2(default 0.05)
source · slewswitch.ts
tempolock utility

Beat-tracking clock: a raw onset train in (e.g. SYNESTHESIA band trigger firing on every kick) -> tracked STEADY quarter-note clock out, never a passthrough of input edges. Inter-onset gaps are read as integer multiples of one base pulse (tolerance-window greatest-common-pulse), folded into a selectable BPM band by octave (60-120 / 90-180 / 120-240) with hysteresis toward the current lock, then a phase accumulator emits the clock with gentle PLL correction from onsets near predicted beats/half-beats. Silent from cold until the first lock; free-runs forever through input dropouts (locked gate drops after ~4 missed beats); bpm CV = tracked BPM / 300.

tempolockingateclockgatebpmcvlockedgateaudiocvgatepitch

inputs

ingateGate signal (rising/falling edge).

outputs

clockgateGate signal (rising/falling edge).
bpmcvControl voltage.
lockedgateGate signal (rising/falling edge).

params

rangediscrete0..2
source · tempolock.ts

processors

905 Spring Reverberation (moogafakkin System 55 clone — categorized under Ports -> moogafakkin). The classic spring-tank reverb: metallic, dispersive, with the characteristic "boing"/chirp on transients. In-house dispersive-allpass spring model — a cascaded all-pass chain (the dispersion) feeding a modulated feedback delay with damping. MIX blends dry/wet, DECAY sets the tail length, SIZE the spring length/character. Own-code (clean-room; feedback-clamped for stability). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

905 spring reverbaudioaudioaudioaudioaudiocvgatepitch

inputs

audioaudioAudio signal.

outputs

audioaudioAudio signal.

params

mixlinear0..1(default 0.35)
decaylinear0..1(default 0.6)
sizelinear0..1(default 0.5)
source · moog905.ts
resofilter processors

Multi-mode filter — clean-room TypeScript port of gabrielsoule/resonarium's MultiFilter (Source/dsp/MultiFilter.{h,cpp}). 5 modes drawn straight from upstream's MultiFilter::Type enum and filterTextFunction: LP / HP / BP / Notch / Allpass. All five characters share a single Cytomic / Zavalishin TPT state-variable filter per channel, so the MODE knob is a pure output picker — switching modes mid-render is pop-free. Cutoff 20 Hz – 20 kHz (log), resonance 0..1 (k = 2 − 2·res, edge-of-self-oscillation at the top), per-param CV inputs (cutoff_cv, reso_cv) sum into the AudioParams with a 50 Hz internal one-pole smoother on cutoff to prevent the steep transfer function from clicking on rapid CV jumps. Stereo input (independent L/R SVF state). The card displays the long-form mode name (e.g. "Low-pass") in a label next to the MODE knob — the headline UX feature: the dial updates the text reactively as you turn it. Drive is intentionally omitted (upstream MultiFilter has no drive stage; saturation lives in WrappedSVF / Distortion which is out of scope for this port).

resofilteraudioaudiocutoff_cvcvreso_cvcvout_laudioout_raudioaudiocvgatepitch

inputs

audioaudioAudio signal.
cutoff_cvcvCV -> cutoff param.
reso_cvcvCV -> resonance param.

outputs

out_laudioAudio signal.
out_raudioAudio signal.
source · resofilter.ts
sidecar processors

Stereo sidechain compressor — Giannoulis-Massberg-Reiss 2012 JAES topology (cross-checked against Faust's co.compressor_stereo). Stereo audio in, dedicated SC L/R inputs (with normalling fallback: both unpatched → self-detect on the audio pair, the typical "use this as a plain stereo comp" default). The SC detector path runs a one-pole HPF (sc_hpf 20..1000 Hz, default 20 = effectively off) for kick-immune bus compression, then |sL|+|sR| stereo-link rectifier → log2 → 3-region soft-knee gain computer → asymmetric one-pole smoother (attack 0.1..200 ms log, release 1..2000 ms log) → linear gain via 2^(gainDb/6.0205). Stereo-link is always on in v1 so transients never shift the image under compression. Two ENV outputs expose the reduction envelope for cross-patch ducking: env_out = (-gainDb / 24) * envMag (NO clamp — at envMag>1 the output can overshoot 1.0, by spec), and env_inv_out = 1 - env_out (the canonical "patch this into a VCA strength to make it close when the comp fires"). Threshold (-60..0 dB) and envMag (0..2) are CV-modulatable; ratio, attack, release, knee, makeup, and sc_hpf are knob-only. Per-sample param smoothing kills clicks on rapid threshold / envMag changes. The 6.0205 factor (= 20·log10(2)) is the GMR-canonical log2↔dB bridge that lets the smoother run cleanly in the dB domain.

sidecaraudio_l_inaudioaudio_r_inaudiosc_l_inaudiosc_r_inaudiothreshold_cvcvenv_mag_cvcvinput_level_cvcvaudio_l_outaudioaudio_r_outaudioenv_outcvenv_inv_outcvaudiocvgatepitch

inputs

audio_l_inaudioAudio signal.
audio_r_inaudioAudio signal.
sc_l_inaudioAudio signal.
sc_r_inaudioAudio signal.
threshold_cvcvCV -> threshold param.
env_mag_cvcvCV -> envMag param.
input_level_cvcvCV -> inputLevel param.

outputs

audio_l_outaudioAudio signal.
audio_r_outaudioAudio signal.
env_outcvControl voltage.
env_inv_outcvControl voltage.

params

thresholddB-60..0(default -18)
ratiolog1..20(default 4)
attackms0.1..200(default 10)
releasems1..2000(default 100)
kneedB0..24(default 6)
envMaglinear0..2(default 1)
inputLevel%0..2(default 1)
makeupdB0..24(default 0)
sc_hpfHz20..1000(default 20)
source · sidecar.ts

filter

923 Filters / Noise Source (moogafakkin System 35 clone — categorized under Ports -> moogafakkin). White + pink noise outputs PLUS a fixed filter utility on an external audio input: independent low-pass and high-pass taps with LO PASS / HI PASS cutoff knobs (log-mapped ~40 Hz-20 kHz). Own-code (noise generator + biquad filters). Beige moogafakkin faceplate (the intrinsic always-on look shared by the moogafakkin module family).

923 filters / noise sourceaudioaudiowhiteaudiopinkaudiolpaudiohpaudioaudiocvgatepitch

inputs

audioaudioAudio signal.

outputs

whiteaudioAudio signal.
pinkaudioAudio signal.
lpaudioAudio signal.
hpaudioAudio signal.

params

levellinear0..1(default 0.8)
lpCutofflinear0..1(default 0.5)
hpCutofflinear0..1(default 0.5)
source · moog923.ts

games

frogger games

Interactive Frogger game module (clean-room TypeScript port of Adrian Eyre's React Frogger, MIT-licensed). FULL CV-gate control with NO keyboard exposure on the module: five gate inputs (up_gate / down_gate / left_gate / right_gate / start_gate) are rising-edge triggered to play the game. The start_gate auto-fires once on module-spawn (a synthesized first-tick rising edge) so the user sees a running game by default — the upstream React app's pre-game InfoBoard ("click Start Game") is bypassed via this synthetic pulse. The same start_gate is rising-edge triggered by external CV to restart at any time. Three gate outputs fire one 5 ms pulse per event: home_gate (a frog reached one of the 5 home slots — fires up to 5 times per level), dead_gate (frog hit a vehicle, fell in water without a raft, or the per-level timer ran out), level_gate (all 5 homes filled — level complete). One knob: TIME (10..120 s, default 60) sets the per-life timer ceiling, and it applies to the RUNNING game — lowering it clamps the life already in progress, raising it takes effect on the next life. Game logic runs at visual cadence on the main thread (no audio worklet); pure deterministic state stepper in frogger-state.ts with NO RNG anywhere, so the board is a pure function of tick count. The 14×13 grid renders at the head of the module's dock faceplate and on the legacy card. See docs/design/game-modules.md for the multi-user follow-up path.

froggerup_gategatedown_gategateleft_gategateright_gategatestart_gategatehome_gategatedead_gategatelevel_gategateaudiocvgatepitch

inputs

up_gategateGate signal (rising/falling edge).
down_gategateGate signal (rising/falling edge).
left_gategateGate signal (rising/falling edge).
right_gategateGate signal (rising/falling edge).
start_gategateGate signal (rising/falling edge).

outputs

home_gategateGate signal (rising/falling edge).
dead_gategateGate signal (rising/falling edge).
level_gategateGate signal (rising/falling edge).

params

initialTimelinear10..120
source · frogger.ts
modtris games

Interactive Tetris-clone game module (single-user research prototype). Five gate inputs (rotate_l / rotate_r / drop_fast / move_l / move_r) are rising-edge triggered to play the game; two gate outputs fire one 5 ms pulse per event — line_cleared (a Tetris emits four separate staggered pulses, one per line) and overfill (game over). Game logic runs at visual cadence on the main thread (no audio worklet), with a deterministic, tested state stepper. Patch a sequencer or controller into the inputs and route the cleared-line / overfill gates as triggers, turning gameplay into a modulation source. See docs/design/game-modules.md.

modtrisrotate_lgaterotate_rgatedrop_fastgatemove_lgatemove_rgateline_clearedgateoverfillgateaudiocvgatepitch

inputs

rotate_lgateGate signal (rising/falling edge).
rotate_rgateGate signal (rising/falling edge).
drop_fastgateGate signal (rising/falling edge).
move_lgateGate signal (rising/falling edge).
move_rgateGate signal (rising/falling edge).

outputs

line_clearedgateGate signal (rising/falling edge).
overfillgateGate signal (rising/falling edge).

params

gravityBpmlog30..240(default 60)
levelSteplinear1..20(default 10)
source · modtris.ts
pong games

Interactive Pong game module (single-user research prototype). Two CV inputs (paddle_left / paddle_right) set each paddle's Y position; two gate outputs (score_left / score_right) fire one 5 ms pulse per scoring event, sample-accurate on the audio thread. The deterministic state stepper runs at visual cadence on the main thread (no audio worklet). Drive the paddles from LFOs / envelopes / joysticks and use the score gates as triggers — the game becomes a generative modulation source. Multiplayer is a planned additive follow-up (the design doc lays out the SyncedModuleDef path). See docs/design/game-modules.md.

pongpaddle_leftcvpaddle_rightcvscore_leftgatescore_rightgateaudiocvgatepitch

inputs

paddle_leftcvControl voltage.
paddle_rightcvControl voltage.

outputs

score_leftgateGate signal (rising/falling edge).
score_rightgateGate signal (rising/falling edge).

params

speedlog0.25..4(default 1)
paddleHlinear0.05..0.5(default 0.2)
serveAnglelinear0..1(default 0.3)
freezelinear0..1(default 0)
source · pong.ts
skifree singleton games

The classic SKIFREE (ski downhill, dodge trees / rocks / jumps, get chased and EATEN by the abominable snowman) as a CV-controlled game module — a thin wrapper around the upstream skifree.js engine (MIT, Daniel Hough 2013). Single-instance per rack (maxInstances:1). Two bipolar CV inputs (x / y, −1..+1) synthesize the mouse cursor the skier steers TOWARD: x = cursor X across the canvas (0 = left edge, +1 = right edge), y = cursor Y (the skier always heads downhill; cursor position sets the steering angle + speed). When x and y are BOTH unpatched AND the card is focused, native mouse control engages — steer the skier with the real mouse directly on the canvas. Any patched CV OVERRIDES the mouse (the factory writes the CV cursor each scheduler tick; the card disables mouse). One gate output: a rising-edge 10 ms pulse on every CRASH (hitting a tree / rock / snowboarder / failed jump) OR when the yeti EATS the skier — hooked to the engine's hasHitObstacle callback (upstream fires it for crashes and, via isEatenBy, for eats), so the game becomes a trigger source for envelopes / sequencers. One video output (out): the game canvas mirrored each video frame via the cross-domain audio→video bridge — patch SKIFREE → VIDEO OUT / BENTBOX / any video module to send the ski-slope render downstream (mirrors the DOOM `out` pattern). vizPassthrough on the on-card canvas so a containing GROUP can portal it across-domain. No audio worklet — the gate is a ConstantSourceNode pulsed on the event (PONG's pattern); the game logic runs at rAF cadence inside the bundle. Bundle committed pre-built at /skifree/skifree.bundle.js (~24 KB, esbuild IIFE of the upstream js/ classes + a thin embed wrapper); sprite sheets at /skifree/*.png. See packages/web/native/skifree/README.md for the regeneration recipe + attribution.

skifree · singletonxcvycvgategateoutvideoaudiocvgatepitch

inputs

xcvControl voltage.
ycvControl voltage.

outputs

gategateGate signal (rising/falling edge).
outvideovideo
source · skifree.ts

video-effects

mandleblot video-effects

MANDLEBLOT is a 2D Mandelbrot fractal generator rendered on the GPU. A WebGL2 fragment shader runs the escape-time loop (z = z² + c, bailout radius 16) per pixel, then smooth-colours it with the standard fractional-iteration trick (mu = i + 1 - log(log|z|)/log2) so colour bands don't stairstep. The same program renders twice per frame: a greyscale escape-time field to mono_out and an RGB-cycling palette to color_out, where hue is driven by iteration band (mu), time, and log(zoom) so each zoom depth feels like its own palette. It is a pure generator with no video input — it synthesizes the fractal from scratch. Frame it with X/Y, drive Zoom by hand or via zoom_cv (LFO/envelope) for an automatic dive into the seahorse valleys, raise Iter for filament detail in deep zooms, and use Color/Rot to animate the look. Single-precision highp-float caps usable zoom near 1e6×, past which the image goes block-y.

mandleblotzoom_cvcvmono_outmono-videocolor_outvideoaudiocvgatepitch

inputs

zoom_cvcvCV -> zoom param.

outputs

mono_outmono-videomono-video
color_outvideovideo

params

zoomlog0..1
rotationlinear0..1
iterationsdiscrete50..500
color_cyclelinear0..4
center_xlinear-2..2
center_ylinear-2..2
source · mandleblot.ts
shapegen video-effects

shapegen is a generative 3D-shape video synthesizer (extracted from FOXY's shape path). It has no straight video pass-through input: instead it reads three incoming rasters as control surfaces and synthesizes a scene of up to 8 lit primitives (sphere, cube, cone, cylinder, ring/torus, tetrahedron) floating inside a vaporwave wireframe bounding box with a faint perspective floor grid. Each raster is downsampled to an 80x60 RGBA buffer and fed to generateShapes: A's 16x16 mean-luma feature grid yields the top-8 peaks (non-max-suppressed) that place shapes in XY (if A is flat below the variance floor, NO shapes are drawn), B's luma at each peak sets Z depth, and C's luma picks the primitive type bucket (floor(c*6)), the baseline radius (0.05+c*0.25) and the hue (=c). The product of A and B luma at each peak gives a per-shape size factor of 0.5x-2x. The whole scene is painted to an OffscreenCanvas, uploaded as a texture, and blitted out a fullscreen quad. Usage: patch any three video sources into A/B/C, twist ROT to orbit the camera, raise SIZE to fatten the primitives, and flip SOLIDS for shaded vs neon-wireframe looks; patch a gate into CLK to freeze the shape set and only re-roll it on each rising edge (a visual sample-and-hold) while the camera keeps rotating.

shapegenraster_avideoraster_bvideoraster_cvideooutvideoaudiocvgatepitch

inputs

raster_avideovideo
raster_bvideovideo
raster_cvideovideo

outputs

outvideovideo

params

sizelinear0.1..3
rotatelinear0..1
solidsdiscrete0..1
source · shapegen.ts
warren's visions singleton video-effects

The visual analogue of WARREN'S SPECTRUM — a 2D spectral video resynthesizer. Every SLICE frames it downsamples VIDEO IN to a 128×128 luma plane, runs a 2D FFT, and picks the strongest peaks in the WAVEVECTOR plane: each peak is a sine grating whose radius is how fine the pattern is, whose angle is its orientation, whose magnitude is contrast and whose phase is where it sits. Peaks are ranked by SALIENCE, snapped toward a detected lattice comb by LOCK, matched frame to frame as tracks, and everything unclaimed is measured in 16 log-spaced RINGS and replayed as procedural texture (the SMS residual — grain, foliage, smoke). The bank is summed back through an inverse FFT and composited against the source. COHERENCE is the control the module exists for and has no audio counterpart: at 1 each component's phase is re-seated on the phase measured in the incoming frame, giving a recognisable sparse reconstruction; at 0 phase is seated at track birth and free-runs — the literal audio behaviour — and the picture drifts off into a moving interference painting with the source's spectrum and none of its geometry. COMPONENTS (1-256) sets density and CPU; FLOOR/STABILITY gate which peaks earn a slot; SLEW smears contrast; DRIFT gives each component its own phase velocity so the picture boils; SHAPE morphs every grating sine→saw→square by harmonic injection; CENTER transposes every wavevector, zooming the reconstruction; FREEZE (control or GATE) holds the bank as a still; MIX crossfades against the source. Resynthesizes LUMA and keeps the source's chroma. An EFFECT — nothing patched in means black — and capped at ONE instance. v1 defers MASSPASS, the editable post-filterbank, independent RGB tracking and a 256² grid.

warren's visions · singletonvideo_invideogategatecomponents_cvcvcoherence_cvcvresidual_cvcvshape_cvcvcenter_cvcvdrift_cvcvmix_cvcvoutvideoaudiocvgatepitch

inputs

video_invideovideo
gategateGate signal (rising/falling edge).
components_cvcvCV -> visionsComponents param.
coherence_cvcvCV -> visionsCoherence param.
residual_cvcvCV -> visionsResidual param.
shape_cvcvCV -> visionsShape param.
center_cvcvCV -> visionsCenter param.
drift_cvcvCV -> visionsDrift param.
mix_cvcvCV -> visionsMix param.

outputs

outvideovideo

params

visionsCoherencelinear?..?
visionsComponentsdiscrete?..?
visionsFloordB?..?
visionsStabilityfr?..?
visionsSlews?..?
visionsSlicefr?..?
visionsResiduallinear?..?
visionsShapelinear?..?
visionsCenterct?..?
visionsDriftlinear?..?
visionsMixlinear?..?
engineFreezediscrete?..?
source · warrensvisions.ts

hybrid

SPECTROGRAPH — a real-time scrolling sonogram VIDEO generator. Takes ONE mono audio input and renders a log-binned spectrograph: FREQUENCY on the vertical axis (log scale, 20 Hz at the BOTTOM up to 20 kHz / Nyquist at the top), TIME scrolling horizontally with the NEWEST column at the RIGHT (older content slides off the left). Model: an AnalyserNode tap (1024-pt FFT, getFloatFrequencyData dBFS) on the input is log-binned into 128 perceptual rows per column spanning [20 Hz .. 20 kHz] (each row picks the nearest FFT bin to its target Hz, DC skipped); magnitudes are normalized over a -90 dBFS (quiet) .. -10 dBFS (loud) display window and written into a 256-wide circular column buffer that advances at most once per ~16 ms frame (steady scroll independent of how many outputs are patched). The binning + colormap math is the same algorithm WAVESCULPT uses for its spectrograph view (video_mode 2), lifted into a pure GPU-free core. TWO video outputs render the SAME binned dB plane through two different colormaps — both always live regardless of which the on-card preview shows. IO — IN (audio): the mono signal to analyse. COLOR OUT (mono-video): the blue→cyan→yellow→red HEAT colormap (loud = hot/red, quiet = dark blue/black) — the classic colored spectrogram. B/W OUT (mono-video): INVERTED grayscale — quiet = light/WHITE, loud = dark/BLACK — i.e. the classic PRINTED-SONOGRAM look (light page, dark traces). Controls — GAIN: a pre-analysis input trim (×0.25 .. ×4, LOG taper, unity at center) applied by a GainNode BEFORE the analyser, so you can boost a quiet source up into the -90..-10 dB display window (or tame a hot one) without changing the displayed dynamic range. GAIN is MIDI / control-surface assignable (right-click → MIDI Learn) like every other knob. A card VIEW toggle (COLOR / B/W) just switches which output the on-card preview shows — it does not change either output. All patching is via the card's yellow drill-down PATCH PANEL (top-left / top-right affordances → INPUT / OUTPUT) — no side jacks. It is a `domain: audio` module that exposes VIDEO outputs through the audio→video texture bridge (the SYNESTHESIA / WAVESCULPT cross-domain pattern), so you patch COLOR / B/W OUT straight into any video module or the video OUTPUT. Usage: drop it on any audio bus to SEE the spectral content of a synth / drum / mix in real time — patch COLOR into the video OUTPUT for the colored sonogram, or B/W for the printed-paper look; feed it from a SCALER / mixer to pick which signal you scope.

spectrographinaudiocolormono-videobwmono-videoaudiocvgatepitch

inputs

inaudioAudio signal.

outputs

colormono-videomono-video
bwmono-videomono-video

params

gainlog0.25..4(default 1)
viewdiscrete0..1(default 0)
source · spectrograph.ts

Audio→video event processor modeled on the LZX Sensory Translator — two independent copies (A/B), each switchable between AUDIO and VIDEO mode. In AUDIO mode a copy splits its mono input into 4 MUSICAL spectral bands (bass 20–200 / low-mid 200–1k / high-mid 1k–4k / treble 4k+ Hz) so a drum kit lands cleanly across the bands (kick→band1, snare→band2/3, hats→band4). In VIDEO mode the 4 lanes become the R/G/B/Luma channels of a patched video frame (a_video_in / b_video_in cross-domain inputs): the card averages the frame to per-channel 0..1 levels (solid red maxes R, solid white maxes all incl. luma). In BOTH modes each lane derives a gained audio/CV tap, slow (500 ms) + fast (50 ms) envelope-follower CV (real ~2/40 ms attack so a kick onset hits the band CV hard + locked to the transient, without strobing video), boosted by a per-band CV makeup gain so a STRONG kick drives the bass CV to (near) full scale — patch it into a continuous CV input (e.g. OUTLINES rotation) and a strong kick runs the whole range. A hysteresis gate (keyed off the un-boosted envelope, so its timing + the gibribbon game feel are unchanged), a per-band BEAT TRIGGER (a ~10 ms pulse from a spectral-flux onset detector with an adaptive threshold + 80 ms debounce — fires once per kick/snare/hat, NOT continuously on a sustained tone), a 10-bar green→red VU meter, and a mono-video raster. Master gain (0.5–1.5×) sets the floor; per-band gain (1–2×) adds on top. A per-band ENV-OUTPUT DEPTH knob (8 = 2 copies × 4 bands, range 0..2, default 1× = unchanged) scales BOTH that band's env CV outputs (env_slow + env_fast) together — the source-side modulation-depth control: turn it down (0 = silenced) to tame a band's envelopes, or up (toward 2×, clamped at the 0..1 CV ceiling) so even a weak band reaches full modulation depth at the SOURCE. It only touches the two env CV outputs — gate / beat-trigger / band-audio / VU are unaffected. Patch a band trigger into a video switch/flash to cut video on the beat; patch the slow envelopes for smooth colour modulation.

synesthesiaa_inaudiob_inaudioa_video_invideob_video_invideoa_band1_audioaudioa_band1_env_slowcva_band1_env_fastcva_band1_gategatea_band1_triggatea_band1_rastermono-videoa_band2_audioaudioa_band2_env_slowcva_band2_env_fastcva_band2_gategatea_band2_triggatea_band2_rastermono-videoa_band3_audioaudioa_band3_env_slowcva_band3_env_fastcva_band3_gategatea_band3_triggatea_band3_rastermono-videoa_band4_audioaudioa_band4_env_slowcva_band4_env_fastcva_band4_gategatea_band4_triggatea_band4_rastermono-videob_band1_audioaudiob_band1_env_slowcvb_band1_env_fastcvb_band1_gategateb_band1_triggateb_band1_rastermono-videob_band2_audioaudiob_band2_env_slowcvb_band2_env_fastcvb_band2_gategateb_band2_triggateb_band2_rastermono-videob_band3_audioaudiob_band3_env_slowcvb_band3_env_fastcvb_band3_gategateb_band3_triggateb_band3_rastermono-videob_band4_audioaudiob_band4_env_slowcvb_band4_env_fastcvb_band4_gategateb_band4_triggateb_band4_rastermono-videoaudiocvgatepitch

inputs

a_inaudioAudio signal.
b_inaudioAudio signal.
a_video_invideovideo
b_video_invideovideo

outputs

a_band1_audioaudioAudio signal.
a_band1_env_slowcvControl voltage.
a_band1_env_fastcvControl voltage.
a_band1_gategateGate signal (rising/falling edge).
a_band1_triggateGate signal (rising/falling edge).
a_band1_rastermono-videomono-video
a_band2_audioaudioAudio signal.
a_band2_env_slowcvControl voltage.
a_band2_env_fastcvControl voltage.
a_band2_gategateGate signal (rising/falling edge).
a_band2_triggateGate signal (rising/falling edge).
a_band2_rastermono-videomono-video
a_band3_audioaudioAudio signal.
a_band3_env_slowcvControl voltage.
a_band3_env_fastcvControl voltage.
a_band3_gategateGate signal (rising/falling edge).
a_band3_triggateGate signal (rising/falling edge).
a_band3_rastermono-videomono-video
a_band4_audioaudioAudio signal.
a_band4_env_slowcvControl voltage.
a_band4_env_fastcvControl voltage.
a_band4_gategateGate signal (rising/falling edge).
a_band4_triggateGate signal (rising/falling edge).
a_band4_rastermono-videomono-video
b_band1_audioaudioAudio signal.
b_band1_env_slowcvControl voltage.
b_band1_env_fastcvControl voltage.
b_band1_gategateGate signal (rising/falling edge).
b_band1_triggateGate signal (rising/falling edge).
b_band1_rastermono-videomono-video
b_band2_audioaudioAudio signal.
b_band2_env_slowcvControl voltage.
b_band2_env_fastcvControl voltage.
b_band2_gategateGate signal (rising/falling edge).
b_band2_triggateGate signal (rising/falling edge).
b_band2_rastermono-videomono-video
b_band3_audioaudioAudio signal.
b_band3_env_slowcvControl voltage.
b_band3_env_fastcvControl voltage.
b_band3_gategateGate signal (rising/falling edge).
b_band3_triggateGate signal (rising/falling edge).
b_band3_rastermono-videomono-video
b_band4_audioaudioAudio signal.
b_band4_env_slowcvControl voltage.
b_band4_env_fastcvControl voltage.
b_band4_gategateGate signal (rising/falling edge).
b_band4_triggateGate signal (rising/falling edge).
b_band4_rastermono-videomono-video

params

a_modediscrete0..1(default 0)
b_modediscrete0..1(default 0)
a_bipolardiscrete0..1(default 0)
b_bipolardiscrete0..1(default 0)
a_masterlinear0.5..1.5(default 1)
b_masterlinear0.5..1.5(default 1)
a_gain1linear1..2(default 1)
a_gain2linear1..2(default 1)
a_gain3linear1..2(default 1)
a_gain4linear1..2(default 1)
b_gain1linear1..2(default 1)
b_gain2linear1..2(default 1)
b_gain3linear1..2(default 1)
b_gain4linear1..2(default 1)
a_envdepth1linear0..2(default 1)
a_envdepth2linear0..2(default 1)
a_envdepth3linear0..2(default 1)
a_envdepth4linear0..2(default 1)
b_envdepth1linear0..2(default 1)
b_envdepth2linear0..2(default 1)
b_envdepth3linear0..2(default 1)
b_envdepth4linear0..2(default 1)
source · synesthesia.ts
Generated from packages/web/src/lib/{audio,video}/module-registry.ts · repo